[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK88186.2

[Show Plain Result]


## Summary of Sequence Search
    1::177
   43::105     1e-06  41%  123 aa  PF06035 DUF920 "Bacterial protein of unknown function (DUF920)"
    1::177

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06035         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLPATPSVSLGDCGDCAAIKRTALAGAGWSSNALRLAF
PF06035         --------------------------------DYWATPGTGAGDCEDYAIAKYFTLLELGVPAEKLRLTV


                         +         .         .         .         .         *         .:210
query           ALKGDGSLEKVLIVTTDKGDIVLGNxxxxxxxxxxxx
PF06035         VKARRGQGHMVLAVRTDSGDLVLDN------------