[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK88284.1

[Show Plain Result]


## Summary of Sequence Search
    1::427
   11::352     2e-16  29%  354 aa  PF01266 DAO "FAD dependent oxidoreductase"
    1::427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGQSAALHLAEGGLDVILLEAKEIGFGGAGR
PF01266         ----------------------------------------GLSTAYELARRGLKVTVLEKGDIAGGASGR


                         .         .         *         .         .         .         .:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
PF01266         NGGLLHPG-----------LGAEPAPALARLARESLDLLRELAAELGIDFGFRRCGVLVLARDEADLERL


                         +         .         .         .         .         *         .:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
PF01266         ERLAERLRANGVDVELLDAAELRELEPALSPDGGLYYPDGGTVDPARLVRALARAAEEAGVEIRTGTEVT


                         .         .         .         +         .         .         .:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
PF01266         GIEREGGGVTVRTEDGEIRADVVVLAAGAWSDELLPLLGLDLPLRPVRGLVLEPLPGALAAPLLPDGRGV


                         .         *         .         .         .         .         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
PF01266         YVTPRLGGVVIGTTDGRLDLGGDEPRSGDDEDVDLAELLEAARKLFPGLADADIVRAWAGLRPLTPDGLP


                         .         .         .         .         *         .         .:420
query           RFHKFAENVIGFSGYNGRGIAPGTAFGKVIAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01266         IIGRVVPGLYVATGHGGHGLTLAPAAGKLLA---------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxx
PF01266         -------