[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK88297.2

[Show Plain Result]


## Summary of Sequence Search
    1::215
  108::316     7e-53  50%  319 aa  PF08893 DUF1839 "Domain of unknown function (DUF1839)"
   14::82      6e-04  31%  333 aa  PF01992 vATP-synt_AC39 "ATP synthase (C/AC39) subunit"
    1::215

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPDTHGVGYQKEHGKTTVAINRLDLEKRELDYFHNAGFFHLSGEDFDGLFQHHLAETDPPFLPYTEFAKF
PF08893         LPDTRGTSYRREHTKTTIGIDAIDREARRLGYFHNSGYYRLEGEDYDGLFDPPLHETGPPLPPYVEFAKR
PF01992         ----------------------------------------LTREDYENLIQCETLEDLKLLLESTDYGDF


                         .         .         *         .         .         .         .:140
query           ADSNPSPAHIRKTAERLLKFHFSRRPSANPVRAFAKVFPAQVEKVADRPFGFFHKYAFNTLRQLGANFEL
PF08893         RFPPLDEAALCDASLALLRRHLARRPAVNPIRAFREQFPADLEWLAERPLEYFHAYSFNTLRQLGANFEL
PF01992         LDDLPSPLSVRALREKLVEFRYLREQAPGPLKKF------------------------------------


                         +         .         .         .         .         *         .:210
query           AASHLEWLDKQGFSDARDHALKISEVAKTVQFQLARAVTRRKFDALATVLDPAADAWDGLMESLxxxxxx
PF08893         AAHYLRWLEASGFAGAAAACRTIASEAKVVQFRLARAVARGKEDRLEASLDALEAAYDRLVDGL------
PF01992         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxx
PF08893         -----
PF01992         -----