[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK88391.2

[Show Plain Result]


## Summary of Sequence Search
    1::215
    7::125     7e-20  47%  190 aa  PF01810 LysE "LysE type translocator"
    1::215

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPGPDMTLWISRSLREGRAAGFMTLVGTNIGITVHTMLVAFGVAALIV
PF01810         -----------------------PGPDNALVLSQGLRRGRRAGLATALGIALGDLVLILLAALGLGALLA


                         .         .         *         .         .         .         .:140
query           ASPTAFMILKTGGAAYLVWLAIQAIRKGSDFVMVKSTGEKAQASLKSALLNGIWVNLLNPKVIIFFMTFL
PF01810         ASPWLFTVLKLAGAAYLLYLGIKALRSAP--APAAAAAAAPPASLRRSFLQGFLVNLLNPKAILFFLALL


                         +         .         .         .         .         *         .:210
query           PQFVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01810         PQFV------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxx
PF01810         -----