[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for atum0:AAK88515.1

[Show Plain Result]


## Summary of Sequence Search
    1::210
    6::193     4e-39  55%  197 aa  PF02570 CbiC "Precorrin-8X methylmutase"
    1::210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
PF02570         ----------------SFAIIRAELGLHGFSPDEEAVVRRVIHATADFEYADLLRFSPGAVEAGRAALRA


                         .         .         *         .         .         .         .:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSXXXXXXXXXXXXXXXVAIGNAPT
PF02570         GAPIVTDVTMVAAGITKRRLPTGNEVICYLDDPRVAELAKELGITRSAAAMELAAERLPGAIVVIGNAPT


                         +         .         .         .         .         *         .:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVxxxxx
PF02570         ALFELLELIEEGGPRPALVIGVPVGFVGAAESKEALAES--GVPYITVRGRKGGSAVAAAIVNAL-----