[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK85845.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2f9yB1.bssp"
#ERROR : Can't open dsspfile "1on3A2.bssp"
#ERROR : Can't open dsspfile "1on3A1.bssp"
#ERROR : Can't open dsspfile "1od2A1.bssp"
#ERROR : Can't open dsspfile "1pixA2.bssp"
#ERROR : Can't open dsspfile "2f9yA1.bssp"
#ERROR : Can't open dsspfile "1uyvA1.bssp"
#ERROR : Can't open dsspfile "1pixA3.bssp"
#ERROR : Can't open dsspfile "2f6qA1.bssp"
#ERROR : Can't open dsspfile "1dl6A.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "1bnkA.bssp"
#ERROR : Can't open dsspfile "1i3qI1.bssp"
#ERROR : Can't open dsspfile "1i3qL.bssp"

## Summary of PDB Search
:298
    6e-70  49%  2f9yB1 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE CARBOXYL B:23 --
    5e-38  21%  1on3A2 [c.14.1.4] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S A:261
    4e-37  26%  1on3A1 [c.14.1.4] METHYLMALONYL-COA CARBOXYLTRANSFERASE 12S A:8 --
    2e-35  19%  1od2A1 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE A:1484 -- 1814
    3e-29  18%  1pixA2 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:1 --
    1e-23  14%  2f9yA1 [c.14.1.4] ACETYL-COA CARBOXYLASE, CARBOXYLTRANSFERASE A:4
    2e-16  24%  1uyvA1 [c.14.1.4] ACETYL-COA CARBOXYLASE A:1482 -- 1814
    1e-15  16%  1pixA3 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:288 --
    3e-10  16%  2f6qA1 [c.14.1.3] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE A:108
    6e-08  15%  1dl6A  [g.41.3.1] TRANSCRIPTION FACTOR II B (TFIIB)
    1e-06  15%  1ef8A  [c.14.1.3] METHYLMALONYL COA DECARBOXYLASE
    2e-05  13%  1bnkA  [b.46.1.2] PROTEIN (3-METHYLADENINE DNA GLYCOSYLASE)
    1e-04  13%  1i3qI1 [g.41.3.1] DNA-DIRECTED RNA POLYMERASE II 14.2KD I:1 -- 49
    4e-04  15%  1i3qL  [g.41.9.2] DNA-DIRECTED RNA POLYMERASE II 7.7KD POLYPEPTIDE
:298

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxRRPEVPENLWIKCPETGEMVFHKDLEDNKWVIPASGYHMKMPAKARLADLFDG
2f9yB1          -------------------------VWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDE
1on3A2          ----------------------------------------------------------------------
1on3A1          ------------------------------------------------------QGKQTARERLNNLLDP
1od2A1          -----------------------------------------------------YDFPELFRQASSSQWKN
1pixA2          --------------------------------------------------------ELTALQRIEKLVEP
2f9yA1          ----------------------------------------ELEAKIDSDEEVHRLREKSVELTRKIFADL
1uyvA1          ----------------------------------------------------------------------
1pixA3          -------------------------------------------------DKRAYDIY----NVIARLFDN
2f6qA1          ----------------------------------------------------------------------
1dl6A           -----------------SRLDALP--RVTCPNHPDAILVEDYRAGDMICPECGLVVGD------------
1ef8A           ----------------------------------------------------------------------
1bnkA           --------------------------------------------------AHSRGGRQTPRNRGMFMKPG
1i3qI1          ----------------------------FCRDCNNMLYPREDKENNFECRTCSYVEEAG-----------
1i3qL           -------------------------LKYICAECSKLSLS---RTDAVRCKDCGHRILLKARTKRLVQFE-


                         .         .         *         .         .         .         .:140
query           GIYEALAQPKVAQDPLKFRDSKKYTDRLRDSRAKTEQEDTILAGVGLLKGLKIVAVVHEFQFMAGSLGIA
2f9yB1          GSLVELGSELEPKDVLKFRDSKKYKQK------ETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSV
1on3A2          ----------VPIDGKKGYDVRDVIAKIVDWGDKAGYATNLVTAFARVNGRSVGIVANQPSVMSGCLDIN
1on3A1          HSFDEVGAFR------------KHRTTLFGMDKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGET
1od2A1          FSADVLTDDFFISNELIEDENGELTEVEREPGANAIGXVATVKTPEYPRGRQFVVVANDITFKIGSFGPQ
1pixA2          GSWRPL-------------------NTLFNPQGNKNGSVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPG
2f9yA1          GAWQIA---QLARHPQRPYT-LDYVRLAFDEDRAYADDKAIVGGIARLDGRPVMIIGHQKRRNFGMPAPE
1uyvA1          ------------------------------------------------RGRQFVVVANDITFKIGSFGPQ
1pixA3          SELHEYKKG--------YGPEMVTG---------LAKVNGLLVGVGLLMN-YPEYKAAGSVGIGGKLYRQ
2f6qA1          -----------------------------------------------------------------AINTE
1dl6A           ----------------------------------------------------------------------
1ef8A           -----------------------------------------------------------------ALSKV
1bnkA           TLYVYIIYGMYFCMNI---------------SSQGDGACVLLRALEPLEGLETMRQLRSRVLKDRELCSG
1i3qI1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGEAIVKAFERAISERCPLVMFPASGGARMQEGILSLMQLPRTTVAVNMLKEAGMPYIVVLTNPTTGGVT
2f9yB1          VGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVS
1on3A2          ASDKAAEFVNFCDSFNIPLVQLVDVPGFLPGVQQEYGGIIRHGAKMLYAYSEATVPKITVVLRKAYGGAM
1on3A1          QSTKVVETMEQALLTGTPFLFFYDSGGARIQEGIDSLSGYGKMFFANVKLS-GVVPQIAIIAGPCAGGAS
1od2A1          EDEFFNKVTEYARKRGIPRIYLAANSGARIAEEIVPLFQVAWNDAA---NPDKGFQYL---YLTSEGXET
1pixA2          QAECLLRASDTAKTLHVPLVYVLNCSGVKFDEQEKVYPNRRGGGTPNAELNQLGIPVIVGIYGTNPAGGG
2f9yA1          GYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGE--GGSG
1uyvA1          EDEFFNKVTEYARKRGIPRIYLAANSGARI--GMACIRGSGLIAGA-TSRAYHDIFTITLVTCRSVGI-G
1pixA3          GLVKMNEFVTLCARDRLPIVWIQDTTGIDVGNDAEKAELLGLGQSLIYSIQTSHIPQFEITLRKGTA--A
2f6qA1          XYHEIXRALKAASKDDSIITVLTGNGDYYSSGNDLDIPPGGVEEKAVGCFIDFPKPLIAVVNGPAVGI-S
1dl6A           ----------------------------------------------------------------------
1ef8A           FIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELDPLSYDTRMIQKFPKPIISMVEGSVWGGA-
1bnkA           PSK-LCQALAINKSFQRDLA--------------------------------------------------
1i3qI1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ASYAMLGDVHIAEPGAEICFAGKRVIEQTIREKLPEGFQTSEYLLEHGMVDMVIDRREIPDTLASMLKIM
2f9yB1          ASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKL
1on3A2          CNRDLGADAVYAWPSAEIAVMGAEAMRAEKIEEYQNAFNTPYVAAARGQVDDVIDPADTRRKIASALEMY
1on3A1          YS-PALTDFIIMTKKAHMFITGPQVIKSVTGEDVDELGGAEAHMAISGNIHFVAEDDD--AAELIAKKLL
1od2A1          LKKFDKENSVLTER-TVINGEERFVIKTIIGSEDGLGV---ECLRGSGLIAATSRAYHDIFTITLVT---
1pixA2          YHSISPTVIIAHEPKGHVDLEYANEIADMVDRTGKTEPPVDIHYTETGFMREVYASEE--GVLEGIKKYV
2f9yA1          GALAIVGDKVNMLQYSTYSVISPEGCASILWKSADKAGIIRPRLKELKLIDSIIPEPLGGAHRNPEA---
1uyvA1          AYLVRLGQRAIQVEGQPIILTGAPAINKMLGRE-------------------------------------
1pixA3          AHYVLGGPQGNDTNAFSIGTAATEILQPTIDKMNNLIQAFYTKSAELGLVDEIVDMNKIRGYVEAFTEAA
2f6qA1          VTLLGLFDAVYASDRATFHTPFSHLPAKATEXLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAF
1dl6A           ----------------------------------------------------------------------
1ef8A           FEMIMSSDLIIAASTSTFSMTPVNLFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAH--
1bnkA           ----------------------------------------------------------------------
1i3qI1          ----------------------------------------------------------------------
1i3qL           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           TKAPADNAxxxxxxxxxx
2f9yB1          MNLPAPN-----------
1on3A2          ATKRQTR-----------
1on3A1          SFLPQNN-----------
1od2A1          ------------------
1pixA2          GMLP--------------
2f9yA1          ------------------
1uyvA1          ------------------
1pixA3          YQNPESIC----------
2f6qA1          AKLPP-------------
1dl6A           ------------------
1ef8A           ------------------
1bnkA           ------------------
1i3qI1          ------------------
1i3qL           ------------------