[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK85965.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1ea0A2.bssp"
#ERROR : Can't open dsspfile "1ea0A1.bssp"
#ERROR : Can't open dsspfile "1ea0A3.bssp"
#ERROR : Can't open dsspfile "2p3pA1.bssp"
#ERROR : Can't open dsspfile "1vprA1.bssp"
#ERROR : Can't open dsspfile "1rtuA.bssp"
#ERROR : Can't open dsspfile "1jgtA2.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1dorA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1dnpA1.bssp"
#ERROR : Can't open dsspfile "1ao0A2.bssp"
#ERROR : Can't open dsspfile "1te5A.bssp"
#ERROR : Can't open dsspfile "2cwyA1.bssp"

## Summary of PDB Search
:1782
    4e-75  37%  1ea0A2 [c.1.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:423 --
    4e-55  35%  1ea0A1 [b.80.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:1203 --
    6e-37  29%  1ea0A3 [d.153.1.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:1 --
    2e-35  15%  2p3pA1 [d.383.1.1] HYPOTHETICAL PROTEIN A:66 -- 262
    6e-17  10%  1vprA1 [b.60.1.7] LUCIFERASE A:868 -- 1218
    3e-15  12%  1rtuA  [d.1.1.4] RIBONUCLEASE U2
    9e-14  14%  1jgtA2 [d.153.1.1] BETA-LACTAM SYNTHETASE A:4 -- 209
    3e-11  15%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    6e-11  13%  1dorA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE A
    1e-10  14%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    1e-10  12%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    8e-10  16%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    1e-09  18%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    6e-06  14%  1dnpA1 [a.99.1.1] DNA PHOTOLYASE A:201 -- 469
    4e-04  28%  1ao0A2 [d.153.1.1] GLUTAMINE PHOSPHORIBOSYLPYROPHOSPHATE A:1 -- 234
    5e-04  29%  1te5A  [d.153.1.1] CONSERVED HYPOTHETICAL PROTEIN
    0.001  36%  2cwyA1 [a.246.2.1] HYPOTHETICAL PROTEIN TTHA0068 A:1 -- 94
:1782

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNALKEQGFSVLLV
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          -----TGDGAGIHVAVPQKFFKDHVKVIGHPDNKLAVGQVFLPRILDAQEACRCIVETEILAFGYYIYGW
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIEALAYTVPDLAGFYPLSLSAR
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          RQVPINVDIIGEKANATRPEIEQIIVGNNKGVSDEQFELDLYIIRRRIEKAVKGEQIND--FYICSLSAR
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ------------------------------------------------------------------LSPR
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNTDPHPSMAQPFRLMAHNGELNTDKKNRLSEA
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          SIIYKGMFLAEQLTTFYPDLLDERFESDFAIYHQRYSTNTFPTWPLAQPFRMLAHNGEINTVKGNMEHPA
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          --------------------------------------------------GGPVFATRGSHTDIDTQGER
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          QCL-------HRLLAEQPQALDGGA---GSVWLNELIWRE-------FYRHLITYHPSLCKHRPFIAWTD
1ao0A2          --------------------------------HVRYAT----GYENVQPLLFLAHNGNLNATQLKQQLEN
1te5A           -------------------VQRFPIKSETVIGHIRQANVGKVGLSNTHPFITFAHNGQLADFQPKP----
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVALAKNASIVRPKGQSDSCRLDQTLQARVMEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYE
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          FGTHMQDLKPVIGVGLSDSGSLDTVF-EVMVRAGRTAPMVKMMLVPQALTT---TPDNHKALIQYCNSVM
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          AATLVHAPSVAPDRAV-ARSLTGAPT-TAVLAGEIYNRDELLSVLPAGPAPEGDAELVLRLLERYDLHAF
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          RVQWQSNPAHLQAEGKTGYPIVDAA--MRQLNSTGWMHNRLRMITASFLVKDLLIDW--REGERYFMSQL
1ao0A2          QGS--------IFQTSSDT----------------EVLAHLIKR-----SGHFTLKDQIKNSLSML----
1te5A           --------GFYRPVGETDS---------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EKNDGPAALIFGDGTIIGARLDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDH
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          EPWDGPAALAMTDGRWVVGGMDRNGLRPMRYTITTDGLIIGSETGMVKIDETQVIEKGRLGPGEMIAVDL
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          RLVNGRFATVVRTGDRVLLATDHAGSVPLYTCVAPGEVRASTEAALAAHPKGFPLGVYQVPAGAVMDIDL
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          IDGDLAAASTGTDATTQGEKFDHEGEFIRQWLPELR-----------DVPGKVVHEPWKWAQKAGVTLDY
1ao0A2          ---KGAYAFLIMTETEMIVALDPNGLRPLSIGMMGDAYVVASET--CAFDVVGATYLREVEPGEMLIIN-
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           TERRAFSTVEALELLASRRDYxxxxxDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
1ea0A2          --------------------------DELVKTASLKGEPSDMDKAELR--------RRQQAFGLTMEDME
1ea0A1          ----------------------------------------------------------------------
1ea0A3          QSGKLYRDRELKDHLATLKPW-------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          GSGT------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTLRVALGAKPNS
1ea0A2          LILHPMVEDGKEAIGSMGDDSPIAVLSDKYRGLHHFFRQNFSQVTNPPIDSLRERRVMSLKTRLGNLGNI
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEAALRQAIDGLCGEVVAFAAEE
1ea0A2          DETQTRLLQLESPVLTTAEFRAMRDYMGDTAAEIDATFPV-----DGGPEALRDALRRIRQETEDAVRGG
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRISLIVESGQFSSSHHIAAGLGFGASAVYPLG
1ea0A2          ATHVILTDEAMGPARAAIPAILATGAVHTHLIRSNLRTFTSLNVRTAEGLDTHYFAVLIGVGATTVNAYL
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VQFRAEXXXXXXXXXXXXXXXXXXXXSLMKTMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKT
1ea0A2          AQHRRGLFGSMPLEKGMANYKKAIDDGLLKIMSKMGISVISSYRGGGNFEA--IGLSRALVAEHFPAMVS
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PVGGVTFAVIAQAVADWHRKALSVKGENDIPLLGLFKERAEGAGHSYxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          RISGIGLNGIQKKVLEQHATAYN-EEVVALPVGGFYRFRKSGDRHGW-----------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxIRTAPNSIPLETVQKASEITKTLASGAMSXXXXXXXXXXXXXX
1ea0A2          ---------------------------LRSTKAPVPVDEVESITAIRKRFITPGMSMGALSPEAHGTLNV
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           XTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVWAGYLADPMLEEIEIKIGQGAKPGEGGQLPS
1ea0A2          AMNRIGAKSDSGEGGEDPARFGDNWNSAIKQVASGRFGVTAEYLNQ--CRELEIKVAQGAKPGEGGQLPG
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ---LAXPESVLPIVTXLCRRAGHLSGFTHTASLESSLGGTVTFLLNR--NFIRIQTSTVGE---------
1vprA1          ---------------------------------------------------------HVEKYGDNFKNGX
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ------------------------------GFYGL--CIPPSYVVRARYPHAPFRLVTVVGFPLGYQEKE
1dorA           --YITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDY-----YLDYVLKNQKENAQEGPIFFSIAG
1d3gA           ---EIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFLSVVEHRLRARQQKQAKLTEDGLPLNLGKNKTSV
2a4aA1          --------------------------AAAVCVYPKFVKFINEKIKQ-EINPFKPKIACVINFPYGTDSME
1al7A           --------SAAGTIMTL----SSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAER-AGFKAIA
1jcjA           --------------------------TAAICIYPRFIPIARKTLKEQGTPEI--RIATVTNFPHGNDDID
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           PKVTVEIAAARGGTPGVELVSPPPHHDTYSIEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGA
1ea0A2          FKVTEMIARLRHSTPGVMLISPPPHHDIYSIEDLAQLIYDLKQIDAKVTVKLVSRSGIGTIAAGVAKANA
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          --VFXRILPFSDSSSVICVVTTDSRIDFYTT-EWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASL
1vprA1          HKPEFHEDGLHKPXEVGGKKFESGFHYLLECHELGGKNASGGYGGPKLLKEADSDRTLCFNNFQDPCPQL
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           VKALEAALACARGADEVDMVLHLGRDLDYLEAEVRAVREAVPQAVLKVITGYFSPEEIARLAEAAIRGGA
1dorA           MSAAENIAMLIQESDFSGITELGKPQLAYDFEATEKLLKEVFTFTKPLGVKLPDLVHFDIMAEILNQFPL
1d3gA           DAAEDYAEGVRVLGPYLVVNVSSPNTAGLGKAELRRLLTKVLVHRPAVLVKIAPSQDKEDIASVVKELGI
2a4aA1          KVLNDTEKALDDGADEIDLVINYKKIIENTDKLTQSVKKLLTNKILKVIIELKTEDLIIKTTLAVLNGNA
1al7A           LTVDTPRLGRREADIKNRF-VLPPFLTLKNFEGIDLGLSSYVAGQIDDVAWLQTITSLPILVKGVITAED
1jcjA           IALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEALLKVIIETGELKDEALISEISIKAGA
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           DVIXXXXXXXXXXXXXXXSLKYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGD
1ea0A2          DIILISGNSGGTGASPQTSIKFAGLPWEMGLSEVHQVLTLNRLRHRVRLRTDGGLKTGRDIVIAAMLGAE
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          TPSYXQVSLSEESD--------TLSIRQTVTAEEEKPLAAIFLSPEPLVY--------------------
1vprA1          TKEQVAXCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKTNPLHGRWITVSGGQAAFIKEAIKSGMLGAA
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           DFL-----------------KTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGAS
1dorA           TYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQ-------IIGTG
1d3gA           DGLIVTNTTVSRPAGLQGALRSETGGLSGDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
2a4aA1          DFIKTSTGKV--------QINATPSSVEYIIKAIKEYINNPEKNNKIGLKVSGGISDLNTASHYILLARR
1al7A           ARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKA----AQGRIPVFLDGGVRRGTDVFKALALGAA
1jcjA           DFIKTS------------TGKVAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADE
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           SFEFGTTALMMLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
1ea0A2          EFGIGTASLIAMGCIMVRQCSNTCPVGVCVQRQKFVGTPEKVVNLFTFLAEEVREILAGLGFRSLNEVIG
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          EANKIVGGXYLRINQFGDVCTVDASVFARAKRTWKSGHYFYEPLVSGGNLLEYRKIGFFWEXESGRCFRI
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           RLGTSSGVAL------------------------------------------------------------
1dorA           GIETGQDAFEHLLC-GATMLQIGTA---------LHKEGPAIFDR---IIKELEEIMNQKGYQSIADFHG
1d3gA           LVQLYTALTFWGPPVVGK------------------------------VKRELEALLKEQGFGGVTDAIG
2a4aA1          FLSDNFRIGSSSLVIKLRKV--------------------------------------------------
1al7A           GVFIGRPVV----------------------FSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEIS-
1jcjA           LFGADWADARHYR---------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------ATGEERRLLQGVILLAHQRR--LGRPGLRNLRKAEA


                         .         .         .         *         .         .         .:1330
query           RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRRENIELGGNRF
1ea0A2          RTDLLH-------QVDLDLNPRLAQVD-------------------------------------------
1ea0A1          -----------------------------------------TLDARIVADARPLFEEGEKMQLAYN----
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ERRAFPTFXRQATEVGGKISFVFYVKVSNDPESDPIPLQSRGRDNAPTNLGKPYP---------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           KLKSL-----------------------------------------------------------------
1d3gA           ADH-------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           RSHIAADWD-------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          R-----LEGLPCPLXGLDWRSLLQEARRR-----------------------------------------


                         .         +         .         .         .         .         *:1400
query           LNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSVRIDTSGSAGQSFGAFCNDGM
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ARNTQRAIGTRLSSMVTRK--------------------FGMFGLQPGHITIRLRGTAGQSLGAFAVQGI
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------QGALDDVANGDRPDNYPHQYYDSE
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           IMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVGNFALFGATGGRTFVEGQAGDRFAVRNSGAT
1ea0A2          ----------------------------------------------------------------------
1ea0A1          KLEVMGDANDYVGKGLSGGTIVVRPTTSSPLETNKNTIIGNTVLYGATAGKLFAAGQAGERFAVRNSGAT
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           DITLCCGSGPWNGPYYSSRDNYVSGPDRVIYQTNTGEFCATVTHTGAASYDGFTQC--------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           AVVEGVGDFACEYMTNGAVXXXXXXXXXXXXXXXXXFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAI
1ea0A2          ----------------------------------------------------------------------
1ea0A1          VVVEGCGSNGCEYMTGGTAVILGRVGDNFAAGMTGGMAYVYDLDDSLPLYINDESVIFQRIEVGHYESQL
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           HNQAVHQLLTLHVAETGSAKAAWLLENWESEQHNFAYGMPRAxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
1ea0A1          KHL-----IEEHVTETQSRFAAEILNDWAREVTKFWQVVPKE----------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          ----------------------------------------------------------------------
1ea0A1          ----------------------------------------------------------------------
1ea0A3          ----------------------------------------------------------------------
2p3pA1          ----------------------------------------------------------------------
1vprA1          ----------------------------------------------------------------------
1rtuA           ----------------------------------------------------------------------
1jgtA2          ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1dorA           ----------------------------------------------------------------------
1d3gA           ----------------------------------------------------------------------
2a4aA1          ----------------------------------------------------------------------
1al7A           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1dnpA1          ----------------------------------------------------------------------
1ao0A2          ----------------------------------------------------------------------
1te5A           ----------------------------------------------------------------------
2cwyA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ea0A2          --------------------------------
1ea0A1          --------------------------------
1ea0A3          --------------------------------
2p3pA1          --------------------------------
1vprA1          --------------------------------
1rtuA           --------------------------------
1jgtA2          --------------------------------
1j2wA           --------------------------------
1dorA           --------------------------------
1d3gA           --------------------------------
2a4aA1          --------------------------------
1al7A           --------------------------------
1jcjA           --------------------------------
1dnpA1          --------------------------------
1ao0A2          --------------------------------
1te5A           --------------------------------
2cwyA1          --------------------------------