[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fv7A1.bssp"
#ERROR : Can't open dsspfile "1gqtA.bssp"
#ERROR : Can't open dsspfile "1v19A.bssp"
#ERROR : Can't open dsspfile "2afbA1.bssp"
#ERROR : Can't open dsspfile "1wyeA1.bssp"
#ERROR : Can't open dsspfile "1bx4A.bssp"
#ERROR : Can't open dsspfile "2abqA1.bssp"
#ERROR : Can't open dsspfile "1tyyA.bssp"
#ERROR : Can't open dsspfile "2awdA1.bssp"
#ERROR : Can't open dsspfile "1vk4A.bssp"
#ERROR : Can't open dsspfile "1dgmA.bssp"
#ERROR : Can't open dsspfile "1td2A.bssp"
#ERROR : Can't open dsspfile "2ajrA1.bssp"
#ERROR : Can't open dsspfile "1kyhA.bssp"
#ERROR : Can't open dsspfile "1c3qA1.bssp"
#ERROR : Can't open dsspfile "1jxhA.bssp"
#ERROR : Can't open dsspfile "1lhpA.bssp"

## Summary of PDB Search
:299
    2e-55  31%  2fv7A1 [c.72.1.1] RIBOKINASE A:15 -- 322
    5e-50  35%  1gqtA  [c.72.1.1] RIBOKINASE
    6e-40  21%  1v19A  [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE
    3e-39  22%  2afbA1 [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE A:-2 -- 330
    3e-39  23%  1wyeA1 [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE A:2 -- 309
    4e-33  20%  1bx4A  [c.72.1.1] PROTEIN (ADENOSINE KINASE)
    5e-33  22%  2abqA1 [c.72.1.1] FRUCTOSE 1-PHOSPHATE KINASE A:1 -- 306
    3e-32  22%  1tyyA  [c.72.1.1] PUTATIVE SUGAR KINASE
    6e-29  19%  2awdA1 [c.72.1.1] TAGATOSE-6-PHOSPHATE KINASE A:1 -- 313
    2e-26  20%  1vk4A  [c.72.1.1] PFKB CARBOHYDRATE KINASE TM0415
    5e-24  21%  1dgmA  [c.72.1.1] ADENOSINE KINASE
    6e-19  15%  1td2A  [c.72.1.5] PYRIDOXAMINE KINASE
    5e-18  18%  2ajrA1 [c.72.1.1] SUGAR KINASE, PFKB FAMILY A:1 -- 319
    9e-18  15%  1kyhA  [c.72.1.4] HYPOTHETICAL 29.9 KDA PROTEIN IN SIGY-CYDD
    1e-14  13%  1c3qA1 [c.72.1.2] PROTEIN (HYDROXYETHYLTHIAZOLE KINASE) A:1 -- 272
    9e-14  15%  1jxhA  [c.72.1.2] PHOSPHOMETHYLPYRIMIDINE KINASE
    7e-12  24%  1lhpA  [c.72.1.5] PYRIDOXAL KINASE
:299

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATGDDTFAAPALT
2fv7A1          -VVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIE
1gqtA           -LVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQ
1v19A           -VVTAGEPLVALVP-----QEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEE
2afbA1          -VVTFGEIXLRLSP-----PDHKRIFQTDSFDVTYGGAEANVAAFLAQXGLDAYFVTKLPNNPLGDAAAG
1wyeA1          -LITLGEILIEFNA-----LSPGPLRHVSYFEKHVAGSEANYCVAFIKQGNECGIIAKVGDDEFGYNAIE
1bx4A           --------NDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMHKAATFFGCIGIDKFGEILKR
2abqA1          -YTVTLNPSIDYIVQVENFQ-QGVVNRSERDRKQPGGKGINVSRVLKRLGHETKALGFLGGFT-GAYVRN
1tyyA           -VWVIGDASVDLVPEK-----------QNSYLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQ
2awdA1          LITVTXNPSIDISYLLDHL-KLDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLGGFH-GAFIAN
1vk4A           -ITFIGHVSKDVNVVDGKRE------------IAYGGGVVXGAITSSLLGVKTKVITKCTREDVSK--FS
1dgmA           -------------ATPEQMRIYSTLDQFNPTS-LPGGSALNSVRVVQKKPGSAGYMGAIGDDPRGQVLKE
1td2A           -----------------------------------YGHAGNSAAPMRRLGANVWPLNTVQFSNHTQYGKW
2ajrA1          ----------------------------------PGGKGINVSIALSKLGVPSVATGFVGGYXGKILVEE
1kyhA           ----------------------------------------------------------------------
1c3qA1          ----------------------------------------------------------------------
1jxhA           ----------------------------------------------------INALTIAGTDPSGGAGIQ
1lhpA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDATKVVGEMDAGDILMLQFEIPX
2fv7A1          NLKQNDISTEFTYQTKDATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITP
1gqtA           QLATDNIDITPVSVIKGSTGVALIFVNGEGENVIGIHAGANAALSPALVEAQRERIANASALLMQLESPL
1v19A           RLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPA
2afbA1          HLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSKREDFDWEKILDGARSGITPPLGKELPL
1wyeA1          WLRGQGVDVSHMKIDPSPTGIFFIQRHYPSESIYYRKGSAGSKLSPEDVDEYVKSADLSGITLAISSTAK
1bx4A           KAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCHLDLEKNWMLVEKARVCYIAGFFLTVSP
2abqA1          ALEKEEIGLSFIEVE-GDTRINVKIKGKQ-ETELNGTAPLIKKEHVQALLEQLTELEKGDVLVLAGSVPQ
1tyyA           VFQDNGVDVTFLRLDADLTSAVLIVNSFTYLVHPGADTYVSPQDLPPFRQY---EWFYFSSIGLTDRPAR
2awdA1          ELKKANIPQAFTSIK-EETRDSIAILHEGNQTEILEAPTVSPEEISNFLENFDQLIKQAEIVTLAKGLPS
1vk4A           FLRDNGVEVV-FLKSPRTTSIENRYTRESFLI-SAADPFTESDLAFIEGEAVHINPLWYGEFPEDLIPVL
1dgmA           LCDKEGLATRFMVAPGQSTGVCAVLINEK-ERTLCTHLGACGSFRLPEDWTTFASGAYATAYTLTATPKN
1td2A           TGCV-------MPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHIL--------GIVRQVKAANP
2ajrA1          LRKISKLITTNFVYVEGETRENIEIIDEKNKT-ITAINFPGPDVTDXDVNHFLRRLSKVDCVVISGSIPP
1kyhA           ----------------------IGTSENVIPLIVPVLPEATYWRDGWKKAADAQLEETYRAIAIGPGLPQ
1c3qA1          ----------------------------------------------------------------------
1jxhA           ------ADLKTFSALGAGCSVITALVAENTCGVQSVYRIEPDFVAA-QLDSVFSDVRIDTTKIGMLAETD
1lhpA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXKRITTVINTAPLTADGPRLAGLADIVIANETEFELLIGKNGLSSGERESELKALHDRT
2fv7A1          ATSLEALTMARRSGVKTLFNPAPAIADDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRG
1gqtA           ESVMAAAKIAHQNKTIVALNPAPARELPDELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKG
1v19A           LSPEARAFSLWAMEEAKRRGVRVSLDVNYRPEEARGFLERALPGVDLLFLSEEEAELLFGRVEEALRALS
2afbA1          ILEDALKVANEKGVTVRLWTKEEAQKVXIPFXEYVDVLIANEEDIEKVLGISVEGLNREAYAEEVTRKYN
1wyeA1          EAVYKAFEIASNRSFDTNIRLKLWSAEEAKREILKLLLITDTDDSKIILGESD------PDKAAKAFSDY
1bx4A           ESVLKVAHHASENNRIFTLNLSAYKESLMKVMPYVDILFGNETEAATFAREQGFETKKKTQALPKMNSKR
2abqA1          AXPQTIYRSXTQRGAFVAVDTSG-EALHEVLAAKPSFIKPNHHELSELVSKPIASIEDAIPHVQRLIGEG
1tyyA           EACLEGARRXREAGGYVLFDVNLRSKXWGNSAALASICKVSADELCQLSGAS-----HWQDARYYLRDLG
2awdA1          DFYQELVQKAHAQEVKVLLDTSGDSLQVLQGPWKPYLIKPNLEELEGLLGQDFSENPAVQTALTKPXFAG
1vk4A           RRKVXFLSADAQGFVRVPENEKLVYRDWEKYLKYLDLFKVDSREAETLTGTNDL-----RESCRIIRSF-
1dgmA           AFEVAGYAHGIPNAIFTLNLSAPFCVELYKLLLHTNILFGNEEEFAHLAKVHNLVTANKEHAVEVCTGNT
1td2A           QAKYFCDPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELIAQG
2ajrA1          GVNEGICNELVRRGVFVFVEQTPRLLERIYEGPEFPNVVKPDLRGNHFLGVDLKTFDDYVKLAEKLAEK-
1kyhA           TESVQQAVDHVLTACPVILDAGALAKRTYPKREGPVILTPHPGEFFRXTGVPVNELKKRAEYAKEWAAQ-
1c3qA1          ----------------------TESARDIIREVRLAAIRGNAAEIAHTVGVTDWLIKGVDAGAQQAAQKL
1jxhA           IVEAVAERLQRHHVRNVVLDTVMLLLSPSRLLPQVSLITPNLPEAAALLDAPHARTQEMLAQGRALLAMG
1lhpA           -----------------------------KVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMG


                         .         .         .         +         .         .         .:280
query           GQTLIVTLGADGVIAMRNGKVFSASGLKIEPVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLAC
2fv7A1          CQVVIITLGAEGVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLYPNLSLEDMLNRSNFIAAVSV
1gqtA           IRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAV
1v19A           APEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRLANLLGASVA
2afbA1          FKTVGITLRYWSVXVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLXGFDSQKKAEFAAAASCLKH
1wyeA1          AEIIVMKLGPKGAIVYYDGKKYYSSGYQVPVEDVTGAGDALGGTFLSLYYKGFEMEKALDYAIVASTLNV
1bx4A           QRIVIFTQGRDDTIMATESEVTAFAVLDQDQKDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIII
2abqA1          IESILVSFAGDGALFASAEGXFHVNVPSGEVRNSVGAGDSVVAGFLAALQEGKSLEDAVPFAVAAGSATA
1tyyA           CDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRANCWDHALLAEAISNANAC
2awdA1          IEWIVISLGKDGAIAKHHDQFYRVKIPTIQAKNPVGSGDATIAGLAYGLAKDAPAAELLKWGXAAGXAN-
1vk4A           GAKIILATHASGVIVF-DGNFYEASFRSWSLEGRTGRGDTCTAFLVGFVFKKXSIEKATKFAAAVTSVKX
1dgmA           GATVVMTRGHNPVIAAEQTAVVHEVGVAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVI
1td2A           PQIVLVKHLARAGYSRDEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATLQEALEHVTAAVYEIM
2ajrA1          SQVSVVSYEVKNDIATREGVWLIRSKEEIDTSHLLGAGDAYAGXVYYFIKHGANFLEXAKFGFASALAAT
1kyhA           LQTVIVLKGNQTVIA-FPDGDCWLNPTGNGALAKGGTGDTLTGXILGXLCCHEDPKHAVLNAGACAELWT
1c3qA1          NTVIAITGEVD--VIADTSHVYTLHNGHKLLTKVTGAGCLLTSVVGAFCAVEENPLFAAIAAISSYGVAA
1jxhA           CEAVLMKGDWLFTR-------EGEQRFRVNTKNTHGTGCTLSAALAALRPRHRSWGETVNEAKAWLSAAL
1lhpA           PDTVVITLGSQRTRGSVVTQRIRMEMHKV-DAVFVGTGDLFAAMLLAWTHKHPNLKVACEKTVSAMHHVL


                         .         *         .         .         .         .         +:350
query           TRAGAQPSIPQAAEVDAAL
2fv7A1          QAAGTQSSYPYKKDLPLTL
1gqtA           TRKGAQPSVPWREEIDAFL
1v19A           ASRGDHEGAPYREDLEVLL
2afbA1          TIPGDFVVLSI-EEIEKLA
1wyeA1          MIRGDQENLPTTKDIETFL
1bx4A           RRTGCTPEKPD--------
2abqA1          FSDGF--------------
1tyyA           TAKGAXTALPFPDQLNTFL
2awdA1          -------------------
1vk4A           RHPGP----LRREDLEA--
1dgmA           QHVGFSLSFT---------
1td2A           VTTKQEYELQVVAAQDRIA
2ajrA1          RRKE---------------
1kyhA           DEHSAHTLLALSDILPRVW
1c3qA1          QLAAQQTADKGPGSFQIEL
1jxhA           AQADT--------------
1lhpA           QRTIKC-------------