[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86197.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gs5A.bssp"
#ERROR : Can't open dsspfile "2ap9A1.bssp"
#ERROR : Can't open dsspfile "1b7bA.bssp"
#ERROR : Can't open dsspfile "1m0tA2.bssp"
#ERROR : Can't open dsspfile "2akoA1.bssp"
#ERROR : Can't open dsspfile "2df4B1.bssp"
#ERROR : Can't open dsspfile "2cdqA1.bssp"
#ERROR : Can't open dsspfile "2j0wA1.bssp"
#ERROR : Can't open dsspfile "1ybdA1.bssp"

## Summary of PDB Search
:294
    9e-87  31%  1gs5A  [c.73.1.2] ACETYLGLUTAMATE KINASE
    1e-65  42%  2ap9A1 [c.73.1.2] ACETYLGLUTAMATE KINASE A:6 -- 296
    2e-43  22%  1b7bA  [c.73.1.1] CARBAMATE KINASE
    5e-41  11%  1m0tA2 [d.142.1.6] GLUTATHIONE SYNTHETASE A:5 -- 213 A:324 -- 491
    2e-29  20%  2akoA1 [c.73.1.3] GLUTAMATE 5-KINASE A:2 -- 251
    2e-18  14%  2df4B1 [a.182.1.2] ASPARTYL/GLUTAMYL-TRNA(ASN/GLN) AMIDOTRANSFERASE
    4e-06  26%  2cdqA1 [c.73.1.3] ASPARTOKINASE A:25 -- 328
    9e-06  33%  2j0wA1 [c.73.1.3] LYSINE-SENSITIVE ASPARTOKINASE 3 A:3 -- 294
    7e-04  29%  1ybdA1 [c.73.1.3] URIDYLATE KINASE A:6 -- 241
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTSSESEIQARLLAQALPFMQKYENKTIVVKYGGHAMGDSTLGKAFAEDIALLKQSGINPIVVHGGGPQI
1gs5A           -------------------------NPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVVHGGGCVV
2ap9A1          IEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAXTDDTLRRAFAADXAFLRNCGIHPVVVHGGGPQI
1b7bA           -------------------------KKMVVALGGNAILSNDASVQTSAYLVHLIKQGHRLIVSHGNGPQV
1m0tA2          ---------KDQLNELIQEVNQW----AITN--GLSMYPP-------KFEENPSNASVSPVTIYPTPIPR
2akoA1          -------------------------KRIVVKVGSHVISEENRLKNLVAFLAKLXEKYEVILVTSAA---I
2df4B1          ----------------LPDERK---AKYVNELGLPAY----DAHVLTLTKEMSDF--FESTIEHGADVKL
2cdqA1          ----------------------------------------------------------------------
2j0wA1          ----------------------------------------------------------------------
1ybdA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAMLSKMGIESKFEGGLRVTDAKTVEIVEMVLAGSINKEIVALINQTGEWAIGLCGKDGNMVFAEKAKKT
1gs5A           DELMKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDE-
2ap9A1          TAXLRRLGIEGDFKGGFRVTTPEVLDVARXVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVT
1b7bA           GNLLLQQQAAKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAAFKNPTKPIGPFLTEAEAKEAMQAGAI
1m0tA2          KCFDEAVQIQPVFNELYARITQDMAQPDSYLFTGKLWSLYLATLKSAQYKKQNFR---LGIFRSDYLIDK
2akoA1          SAGHTKLDIDRKNLINKQVLAAIGQPFLISVYNELLAK-------------FNKLGGQILLTGKDFDSRK
2df4B1          TSVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSKKVFPELAAKGGNA-------------------
2cdqA1          ----------------------------------------------------------------------
2j0wA1          ----------------------------------------------------------------------
1ybdA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VIDPDSNIERVLDLGFVGEVVEVDRTLLDLLAKSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALHAT
1gs5A           ------------ELGHVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGAD
2ap9A1          VDGVAT------DIGLVGDVDQVNTAAXLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAE
1b7bA           FKEDAGRGWRK-VVPSPKPIDIHEAETINTLIKNDIITIIPVVGQELKGVEAVIDKDFASEKLAELVDAD
1m0tA2          KEQIKQVEFNTVSVSFAGLSEKVDRLHSYLNRANKYDPKGPIYND--QNMVISDSGYLLSKALAKAVESK
2akoA1          ATHAKNAIDXXINLGILPIINEND------------ATAIEEIV--------FGDNDSLSAYATHFFDAD
2df4B1          ----------------------------------------------------------------------
2cdqA1          ---------------------AVAKRLYDDWMHDPAVPIVTGFL-GKGWKTGAVTTDLTATTIGKALGLK
2j0wA1          --------------------------------------------------------DYTAALLAEALHAS
1ybdA1          --------------------------------------------------------DTAAALRGAEXNCD


                         .         .         .         +         .         .         .:280
query           RLLFLTDVPGVLDKNKELIKELTVSEARALIKDGTISGGMIPKVETCIDAIKAGVQGVVILNGKTPHSVL
1gs5A           -LILLSDVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHAEQ-L
2ap9A1          KLLXLTDIDGLYTRWPSLVSEIDTGTLAQLLPTLE--LGXVPKVEACLRAVIGGVPSAHIIDGRVTHCVL
1b7bA           ALVILTGVDYVCINYGKQLTNVTVAELEEYKQAGHFAGSMLPKIEAAIQFVESQPNKQAII---TSLENL
1m0tA2          KIQQLLTDEGVL--GKYISDAEKKSSLLKT----------------------------------------
2akoA1          LLVILSDIDGFYDKNPSEFSDAKRLEKITHIKEEWGTGGIVTKLKAAKFLLEHNKKXFLA-SGFDLSVAK
2df4B1          ----------------------------------------------------------------------
2cdqA1          EIQVWKDVDGVIYKRATPVPYLTFDEAAELAYFG--AQVLHPQ--SMRPAREGEI-PVRVKNSYNP----
2j0wA1          RVDIWTDVPGIYTSAAKRIDEIAFAEAAEMATFG--AKVLHP--ATLLPAVRSDI-PVFVGSSKDP----
1ybdA1          VXLKATNVDGVYTADEALLKNLKVXDATALCRERKLN--------------------IVVFGIAKEGSLK


                         .         *         .         .         .         .         +:350
query           LEIFTEGAGTLIVP
1gs5A           PALFNMPMGTRIL-
2ap9A1          VELFTAGTGTKVVR
1b7bA           GSMSGEIVGTVV--
1m0tA2          --------------
2akoA1          TFLLEDKGGTLF--
2df4B1          --------------
2cdqA1          -----KAPGTIIT-
2j0wA1          -----RAGGTLV--
1ybdA1          RVITGEDEGTLV--