[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86297.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1a04A1.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1jhgA.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1ny5A1.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1qo0D.bssp"
#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "1fseF.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1cb7A.bssp"
#ERROR : Can't open dsspfile "1p2fA2.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "2nx2A1.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"
#ERROR : Can't open dsspfile "1a9xA1.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1a2oA1.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "2b4aA1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "1hcrA.bssp"
#ERROR : Can't open dsspfile "1xn8A.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "1xrsB1.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1skoA.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1rp3A2.bssp"
#ERROR : Can't open dsspfile "1cvrA1.bssp"
#ERROR : Can't open dsspfile "1jhfA1.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"
#ERROR : Can't open dsspfile "1ogcA.bssp"
#ERROR : Can't open dsspfile "1r8jA2.bssp"
#ERROR : Can't open dsspfile "1vz0A1.bssp"

## Summary of PDB Search
:216
    2e-13  40%  1a04A1 [a.4.6.2] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    2e-13  38%  1fseA  [a.4.6.2] GERE
    6e-13  39%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    3e-12  15%  1jhgA  [a.4.12.1] TRP OPERON REPRESSOR
    4e-12  30%  1p4wA  [a.4.6.2] RCSB
    9e-12  19%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    3e-11  18%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    3e-11  17%  1ny5A1 [c.23.1.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) A:1 --
    7e-11  23%  1a0oA  [c.23.1.1] CHEY
    1e-10  12%  1qo0D  [c.23.1.3] AMIR
    1e-10  18%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    3e-10  20%  1dz3A  [c.23.1.1] STAGE 0 SPORULATION PROTEIN A
    3e-10  23%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    5e-10  26%  1fseF  [a.4.6.2] GERE
    6e-10  28%  1p6qA  [c.23.1.1] CHEY2
    6e-10  16%  1cb7A  [c.23.6.1] PROTEIN (GLUTAMATE MUTASE)
    6e-10  18%  1p2fA2 [c.23.1.1] RESPONSE REGULATOR A:1 -- 120
    1e-09  21%  1d5wA  [c.23.1.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-09  10%  2nx2A1 [c.129.1.2] HYPOTHETICAL PROTEIN YPSA A:1 -- 177
    2e-09  20%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    2e-09  18%  1oxbB  [c.23.1.1] SLN1
    3e-09  10%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    3e-09  20%  1tmyA  [c.23.1.1] CHEY PROTEIN
    3e-09  22%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
    5e-09  15%  1a9xA1 [a.92.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
    5e-09  19%  1dcfA  [c.23.1.2] ETR1 PROTEIN
    6e-09  14%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    7e-09  19%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-08  19%  1a2oA1 [c.23.1.1] CHEB METHYLESTERASE A:1 -- 140
    2e-08  22%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    3e-08  13%  2b4aA1 [c.23.1.1] BH3024 A:2 -- 119
    5e-08  12%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    5e-08  20%  1hcrA  [a.4.1.2] PROTEIN (HIN RECOMBINASE)
    6e-08   9%  1xn8A  [a.229.1.1] HYPOTHETICAL PROTEIN YQBG
    2e-07  17%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    2e-07  10%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    3e-07   7%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    5e-07  11%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    6e-07  16%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    2e-06   9%  1xrsB1 [c.23.6.1] D-LYSINE 5,6-AMINOMUTASE BETA SUBUNIT B:102 --
    3e-06  19%  1l5yA  [c.23.1.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    4e-06  23%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    7e-06   7%  1skoA  [d.110.7.1] MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
    8e-06  14%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    2e-05  25%  1dpuA  [a.4.5.16] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    3e-05  20%  1rp3A2 [a.4.13.2] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:164
    7e-05  12%  1cvrA1 [b.1.18.12] GINGIPAIN R A:351 -- 432
    7e-05  20%  1jhfA1 [a.4.5.2] LEXA REPRESSOR A:2 -- 72
    8e-05  12%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    2e-04  12%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
    3e-04  11%  1ogcA  [c.133.1.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    5e-04  20%  1r8jA2 [c.23.1.5] KAIA A:1 -- 135
    7e-04  21%  1vz0A1 [a.4.14.1] CHROMOSOME PARTITIONING PROTEIN PARB A:116 -- 208
:216

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSELVIIIADDHPLFRGALKQAVAGLDGQQTIIEAGDFEAARHAATTRNXXXXXXXXXXXPGVSGFSGLM
1a04A1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1jhgA           ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1s8nA           -----VLIAEDEALIRMDLAEMLREE-GYEIVGEAGDGQEAVELAELHKPDLVIMDVKM-PRRDGIDAAS
1ny5A1          -----VLVIEDDKVFRGLLEEYLSMKG--IKVESAERGKEAYKLLSEKHFNVVLLDLLL-PDVNGLEILK
1a0oA           --ELKFLVVDDFSTMRRIVRNLLKEL-GFNNVEEAEDGVDALNKLQ-AGGYGFVISDWNMPNMDGLELLK
1qo0D           LRELQVLVLNPPGEVSDALVLQLIRI-GCSVRQCWPPPEAFDVPVDVV-------FTSIFQNRHHDEIAA
1iw7F2          ----------------------------------------------------------------------
1dz3A           -----VCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQML-EEKRPDILLLDIIMPHLDGLAVLE
1a04A2          -----ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAE-SLDPDLILLDLNMPGMNGLETLD
1fseF           ----------------------------------------------------------------------
1p6qA           MSLIKVLIVDDQVTSRLLLGDALQQL-GFKQITAAGDGEQG-MKIMAQNPHHLVISDFNMPKMDGLGLLQ
1cb7A           ---LGVIGSDCHAVGNKILDHAFTNAGFNVVNIVLSPQELFIKAAIETKADAILVSSLYGQGEIDCKGLR
1p2fA2          -----IAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEA------FHVVVLDVXLPDYSGYEICR
1d5wA           MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKM--HQSAEAFLAFAPDVRNGVLVTXLRM-PDMSGVELLR
2nx2A1          ----VLAITGYKPFELGIFKQD----DKALYYI-KKAIKNRLIAFLDEGLEWILISGQLGVELWAAEAAY
1m5tA           -----VLIVEDNELNMKLFHDLLEAQG--YETLQTREGLSALSIAR-ENKPDLILMDIQLPEISGLEVTK
1oxbB           -----ILVVEDNHVNQEVIKRMLNLE-GIENIELACDGQEAKELTSKGENYNMIFMDVQMPKVDGLLSTK
1tc3C           ----------------------------------------------------------------------
1tmyA           -----VLIVDDAAFMRMMLKDIITKA-GYEVAGEATNGREAVEKYKELKPDIVTMDITM-PEMNGIDAIK
1resA           ----------------------------------------------------------------------
1a9xA1          -------------------------------------------------------------GATGFDPKV
1dcfA           FTGLKVLVMDENGVSRMVTKGLLVHLG--CEVTTVSSNEECLRVV--SHEHKVVFMDVCMPGVENYQIAL
1i3cA           -----ILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAXAEYENSPRPNLILLDLNLPKKDGREVLA
1b00A           -----ILVVEDEAPIREMVCFV---LEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIK
1a2oA1          MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLI-KKFNPDVLTLDVEMPRMDGLDFLE
1f51E           -----ILIVDDQSGIRILLNEV---FNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILK
2b4aA1          -----VTLVEDEPSHATLIQYHLNQL-GAEVTVHPSGSAFFQHRSQLSTCDLLIVSDQL-VDLSIFSLLD
1y0uA           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1xn8A           -----------------------------LITPDELKSYSVFESVK-TRPDELLKQDILEATADIILKVG
2dk5A1          ----------------------------------------------------------------------
1tu1A           LHEADLEIPDDQSINIFKLPASGPAREAS--FVISRDASQGDAPF---ADYVARQLENAEKQLPGFKLHK
1bmtA2          -----MVIATVHDIGKNIVGVVLQCNNYEIVDLVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVA
1p6rA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1xrsB1          -----IDAIMNMKGYAGHYGLERYEMIDAYNLGSQVANEDFIKKAV-ELEADVLLVSQTVTQKNVHIQNM
1l5yA           -----VFLIDDDRDLRKAMQQTLELAGFT--VSSFASATEALAGLSADFAGIVISDIRM-PGMDGLALFR
1ku3A           ----------------------------------------------------------------------
1skoA           -------------------------------------------------------------SADDLKRFL
1w25A2          -----VLIVDDNERQAQRVAAE---LGVEHRPVIESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAAL
1dpuA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1cvrA1          ASAQTFEVACDYNGAIATLSDDGDM----VGTAIVKDGKAIIKL--NESIADETNLTLTVVGYNKVTVIK
1jhfA1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
2pggA1          MNIAPALVVDSSCLIMNLQIKTYG-----QGSGNAATFINNHLLS-TLVLDQWNLMRQPRPDSEEFKSIE
1ogcA           ------------------------------------------------------------PVPDGVLKID
1r8jA2          ---IAICIWVESTAILQDCQRALSADRYQLQVCESGE-MLLEYAQTHRDQIDCLILVAANPSFRAV--VQ
1vz0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALRAEFSSLPIVIVSATDDATTVRRSIELGASGFISKSSGIDDIRDGIRAVLEGDVWIPSGHQGEKEQDP
1a04A1          ----------------------------------------------------------------------
1fseA           ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1jhgA           ------------------------------AAMAEQRHQEWLRFVDLLKNAYQNDLHLPL---------L
1p4wA           ------------------------------------------------------------------KLLE
1h0mA1          ----------------------------------------------------------------------
1s8nA           EIASKRIAPIVVL-TAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEG--EVATL
1ny5A1          WIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIE-----------------
1a0oA           TIRADMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFE-----------------
1qo0D           LLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAKLKQKGQARIN
1iw7F2          ----------------------------------------------------------------------
1dz3A           RIRGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYG-----------------
1a04A2          KLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAAGEMVLSE----------
1fseF           ----------------------------------------------------------------------
1p6qA           AVRANPAKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGA----------------
1cb7A           QKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE---------------
1p2fA2          XIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLE-----------------
1d5wA           NLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEHLV--------------
2nx2A1          DLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQADYEASLTHRPYESPLQFKQKNQFFIDKSDGL
1m5tA           WLKEDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLER----------------
1oxbB           MIRRDLGYTSPIVATAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTE--------------------
1tc3C           ----------------------------------------------------------------------
1tmyA           EIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKV-------------------
1resA           ----------------------------------------------------------------------
1a9xA1          SLDDPEALTKIRRELKDAGADRIWYIADAFRAGLSVDG---------VFNLTNIDRWF----------LV
1dcfA           RIHEKFTQRLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEP----------------
1i3cA           EIKQNPDRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKXVQGIESFWLETVT----------
1b00A           HLKRETRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR-----------------
1a2oA1          KLMRLRPMPVVMVSSLTGKGSVTLRALELGAIDFVTKPQLGIREGMLAYSEM------------------
1f51E           RMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLP-----------------
2b4aA1          IVKEQTKQPSVLILTTGRL-----IESSEHNLSYLQKPFAISELRAAIDYHK------------------
1y0uA           -----------------------------------------------------GHXSLEEWIKADSLEKA
1hcrA           ----------------------------------------------------------------------
1xn8A           HDFSDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSDVYALIKDYVKPADP
2dk5A1          --------------------------------------------------------------------DS
1tu1A           RWDINIHGHAAVLLDYQWQREGRDLMIERRPAVLITTLTTTPADLPHHEPAWK-----------------
1bmtA2          KEMERQGFTIPGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRI
1p6rA           ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1xrsB1          THLIAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFADDVATFAVKTLND----------------
1l5yA           KILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEKK----------------
1ku3A           ----------------------------------------------------------------------
1skoA           YKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRP-GFLSTFALATDQGSK-----------------
1w25A2          RSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQ-----------------
1dpuA           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1cvrA1          DVKVE-----------------------------------------------------------------
1jhfA1          ----------------------------------------------------------------------
1or7A1          ----------------------------------------------------------------------
2pggA1          DKLGINFKIERSIDDIRGK---------------------------------------------------
1ogcA           LSLKPGL--PAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEI----------------
1r8jA2          QLCFEGVVVPAIVVGDRDPAEQLYHSAEL-----------------------------------------
1vz0A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DVADLIGRLRTLTPQQSRVLGMLAEGLLNKQIAYELNVSEATIKAHVSAILLKLKVDSRTQAVIQLAKIN
1a04A1          -------DVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAV------
1fseA           --------KPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVV------
1yioA1          --DQLEQLFSSLTGREQQVLQLTIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLVH------
1jhgA           NLMLTPDEREALGTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSL-KAAPVELRQWLEEVLLKSD
1p4wA           KISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALL-------
1h0mA1          ----------WLDPKEATYLRWIAVGKTXEEIADVEGVKYNSVRVKLREAXKRFDVRSKAHLTA------
1s8nA           SERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETL----------------
1ny5A1          ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1qo0D           QAKVLLMQRHGWDEREAHSREAMKRREPILKIAQEL----------------------------------
1iw7F2          --------LSKLSEREAMVLKLRKGLIDGEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKL------
1dz3A           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1fseF           -------------------------LLTKREREVFELLVQDKVRNHISNAMQKLGVKGRSQAVV------
1p6qA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2nx2A1          LL--------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1tc3C           -------RGSALSDERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGT---------------
1tmyA           ----------------------------------------------------------------------
1resA           ---------RKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINES--------------------
1a9xA1          QIEELVRLEEKVAEVGITLRQLKRKGFADARLAKLAGVREAEIRKL------------------------
1dcfA           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1y0uA           DEYHKRYNYAVTNPVRRKILRXLDKGRSEEEIXQTLSLSKKQLDYHLKVLEAGFCIERVGERW-------
1hcrA           ------GRPRAINKHEQEISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN-------------
1xn8A           DLEGIEAKVR------------------------------------------------------------
2dk5A1          QNAGK---MKGSDNQEKLVYQIIEDGIWSRDVRYKSNLPLTEINKILK----------------------
1tu1A           ----------------------------------------------------------------------
1bmtA2          QHG-------------------------------------------------------------------
1p6rA           -------KIPQISDAELEVMKVIWKNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPN
1k78A1          QLGGVFVNGRPLPDVVRQRIVELAQGVRPCDISRQLRVSHGCVSKILGRYYETGSI--------------
1xrsB1          ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1ku3A           ---ELEKALSKLSEREAMVLKMDGREHTLEEVGAYFGVTRERIRQIENKALRKLK---------------
1skoA           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1dpuA           -----------LTVAQNQVLNLIKAGLNFQDLKNQLKMSVSSIKQAVDFLSNEGHIYSTVDDD-------
1rp3A2          --------VSKLPEREKLVIQLIFEELPAKEVAKILETSVSRVSQLKAKALERLREMLS-----------
1cvrA1          ----------------------------------------------------------------------
1jhfA1          ---------KALTARQQEVFDLIRDHISRAEIAQRLGFSPNAAEEHLKALARKGVIEIVSGASRGIRLLQ
1or7A1          --------IESLPEDLRMAITLREDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQ-----------
2pggA1          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1vz0A1          -----------LSPEARGYQALLEMGLTQEEVARRVGKARSTVA--------------------------


                         .         .         .         +         .         .         .:280
query           TSAxxx
1a04A1          ------
1fseA           ------
1yioA1          ------
1jhgA           ------
1p4wA           ------
1h0mA1          ------
1s8nA           ------
1ny5A1          ------
1a0oA           ------
1qo0D           ------
1iw7F2          ------
1dz3A           ------
1a04A2          ------
1fseF           ------
1p6qA           ------
1cb7A           ------
1p2fA2          ------
1d5wA           ------
2nx2A1          ------
1m5tA           ------
1oxbB           ------
1tc3C           ------
1tmyA           ------
1resA           ------
1a9xA1          ------
1dcfA           ------
1i3cA           ------
1b00A           ------
1a2oA1          ------
1f51E           ------
2b4aA1          ------
1y0uA           ------
1hcrA           ------
1xn8A           ------
2dk5A1          ------
1tu1A           ------
1bmtA2          ------
1p6rA           IDE---
1k78A1          ------
1xrsB1          ------
1l5yA           ------
1ku3A           ------
1skoA           ------
1w25A2          ------
1dpuA           ------
1rp3A2          ------
1cvrA1          ------
1jhfA1          ------
1or7A1          ------
2pggA1          ------
1ogcA           ------
1r8jA2          ------
1vz0A1          ------