[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86335.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2f9zC1.bssp"

## Summary of PDB Search
:181
    4e-33  40%  2f9zC1 [d.194.1.3] PROTEIN (CHEMOTAXIS METHYLATION PROTEIN) C:1 --
:181

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVTGGDATRYGVH
2f9zC1          --------KVIGIGEYAVMKNPGVIVTLGLGSCVAVCMRDPVAKVGAMAHVMLPDSGGKT-DKPGKYADT


                         .         .         *         .         .         .         .:140
query           LMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKDEGIPVISSSTGGDHGRKIEF
2f9zC1          AVKTLVEELKKMGAKVERLEAKIAGGASMFEKGMNIGARNVEAVKKHLKDFGIKLLAEDTGGNRARSVEY


                         +         .         .         .         .         *         .:210
query           WPVSGRARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2f9zC1          NIETGKLL---------------------------------