[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86457.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kp9A.bssp"
#ERROR : Can't open dsspfile "2o57A1.bssp"
#ERROR : Can't open dsspfile "1nkvA.bssp"
#ERROR : Can't open dsspfile "2ex4A1.bssp"
#ERROR : Can't open dsspfile "1dctA.bssp"
#ERROR : Can't open dsspfile "2dulA1.bssp"
#ERROR : Can't open dsspfile "2ar0A1.bssp"
#ERROR : Can't open dsspfile "1vl5A.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1wxwA2.bssp"
#ERROR : Can't open dsspfile "1bhjA.bssp"
#ERROR : Can't open dsspfile "1uwvA2.bssp"
#ERROR : Can't open dsspfile "1vlmA.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "1yzhA1.bssp"
#ERROR : Can't open dsspfile "2bzgA1.bssp"
#ERROR : Can't open dsspfile "1qzzA2.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "2frnA1.bssp"
#ERROR : Can't open dsspfile "2i6gA1.bssp"
#ERROR : Can't open dsspfile "1xdzA.bssp"
#ERROR : Can't open dsspfile "1ve3A1.bssp"
#ERROR : Can't open dsspfile "1zq9A1.bssp"
#ERROR : Can't open dsspfile "1i4wA.bssp"
#ERROR : Can't open dsspfile "2ckdA1.bssp"
#ERROR : Can't open dsspfile "1yb2A1.bssp"
#ERROR : Can't open dsspfile "1dl5A1.bssp"
#ERROR : Can't open dsspfile "1sqfA2.bssp"
#ERROR : Can't open dsspfile "2f8lA1.bssp"
#ERROR : Can't open dsspfile "2gh1A1.bssp"
#ERROR : Can't open dsspfile "1m6yA2.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "1e50A.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "1vbfA.bssp"
#ERROR : Can't open dsspfile "1xxlA.bssp"
#ERROR : Can't open dsspfile "2fpoA1.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "2p7hA1.bssp"
#ERROR : Can't open dsspfile "2b25A1.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1nv8A.bssp"
#ERROR : Can't open dsspfile "1wznA1.bssp"
#ERROR : Can't open dsspfile "1ws6A1.bssp"
#ERROR : Can't open dsspfile "1y8cA.bssp"
#ERROR : Can't open dsspfile "1qamA.bssp"
#ERROR : Can't open dsspfile "1o9gA.bssp"
#ERROR : Can't open dsspfile "1im8A.bssp"
#ERROR : Can't open dsspfile "2avnA1.bssp"
#ERROR : Can't open dsspfile "1i1nA.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "2avdA1.bssp"
#ERROR : Can't open dsspfile "1ufkA.bssp"
#ERROR : Can't open dsspfile "1xtpA.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1ne2A.bssp"
#ERROR : Can't open dsspfile "1h1dA.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1wy7A1.bssp"
#ERROR : Can't open dsspfile "1eg2A.bssp"
#ERROR : Can't open dsspfile "1qyrA.bssp"
#ERROR : Can't open dsspfile "1t43A.bssp"
#ERROR : Can't open dsspfile "1u2zA.bssp"
#ERROR : Can't open dsspfile "1p91A.bssp"
#ERROR : Can't open dsspfile "1inlA.bssp"
#ERROR : Can't open dsspfile "2esrA1.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1fp2A2.bssp"
#ERROR : Can't open dsspfile "1l9kA.bssp"
#ERROR : Can't open dsspfile "1ri1A.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1jsxA.bssp"

## Summary of PDB Search
:418
    2e-80  35%  1kp9A  [c.66.1.18] CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
    2e-31  19%  2o57A1 [c.66.1.18] PUTATIVE SARCOSINE DIMETHYLGLYCINE A:16 -- 297
    1e-24  18%  1nkvA  [c.66.1.21] HYPOTHETICAL PROTEIN YJHP
    9e-24  13%  2ex4A1 [c.66.1.42] ADRENAL GLAND PROTEIN AD-003 A:2 -- 224
    7e-22   8%  1dctA  [c.66.1.26] PROTEIN (MODIFICATION METHYLASE HAEIII)
    2e-21  11%  2dulA1 [c.66.1.58] N(2),N(2)-DIMETHYLGUANOSINE TRNA A:3 -- 377
    9e-21   9%  2ar0A1 [c.66.1.45] TYPE I RESTRICTION ENZYME ECOKI M PROTEIN A:6 --
    3e-19  13%  1vl5A  [c.66.1.41] UNKNOWN CONSERVED PROTEIN BH2331
    1e-18  12%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    1e-18  11%  1wxwA2 [c.66.1.51] HYPOTHETICAL PROTEIN TTHA1280 A:65 -- 382
    3e-18  11%  1bhjA  [c.66.1.5] GLYCINE N-METHYLTRANSFERASE
    4e-18  10%  1uwvA2 [c.66.1.40] 23S RRNA (URACIL-5-)-METHYLTRANSFERASE RUMA A:75
    2e-17  14%  1vlmA  [c.66.1.41] SAM-DEPENDENT METHYLTRANSFERASE
    5e-17  11%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    5e-16  12%  1yzhA1 [c.66.1.53] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE A:8 --
    7e-16  13%  2bzgA1 [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE A:17 -- 245
    2e-15  19%  1qzzA2 [c.66.1.12] ACLACINOMYCIN-10-HYDROXYLASE A:102 -- 357
    2e-15  11%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    2e-15  16%  2frnA1 [c.66.1.47] HYPOTHETICAL PROTEIN PH0793 A:19 -- 278
    2e-15  24%  2i6gA1 [c.66.1.44] PUTATIVE METHYLTRANSFERASE A:1 -- 198
    3e-15  11%  1xdzA  [c.66.1.20] METHYLTRANSFERASE GIDB
    3e-15  13%  1ve3A1 [c.66.1.43] HYPOTHETICAL PROTEIN PH0226 A:2 -- 227
    4e-15  11%  1zq9A1 [c.66.1.24] PROBABLE DIMETHYLADENOSINE TRANSFERASE A:36 --
    5e-15   6%  1i4wA  [c.66.1.24] MITOCHONDRIAL REPLICATION PROTEIN MTF1
    1e-14   8%  2ckdA1 [c.66.1.57] PUTATIVE METHYLTRANSFERASE A:8 -- 310
    3e-14  27%  1yb2A1 [c.66.1.13] HYPOTHETICAL PROTEIN TA0852 A:6 -- 255
    1e-13  18%  1dl5A1 [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE A:1 --
    2e-13  16%  1sqfA2 [c.66.1.38] SUN PROTEIN A:145 -- 429
    2e-13   9%  2f8lA1 [c.66.1.45] HYPOTHETICAL PROTEIN LMO1582 A:2 -- 329
    4e-13  13%  2gh1A1 [c.66.1.49] METHYLTRANSFERASE A:13 -- 293
    4e-13  16%  1m6yA2 [c.66.1.23] S-ADENOSYL-METHYLTRANSFERASE MRAW A:2 -- 114
    5e-13  19%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    9e-13  13%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    1e-12  12%  1e50A  [b.2.5.6] CORE-BINDING FACTOR ALPHA SUBUNIT
    1e-12  12%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    4e-12  17%  1vbfA  [c.66.1.7] 231AA LONG HYPOTHETICAL PROTEIN-L-ISOASPARTATE O-
    5e-12  21%  1xxlA  [c.66.1.41] YCGJ PROTEIN
    6e-12   8%  2fpoA1 [c.66.1.46] METHYLASE YHHF A:10 -- 192
    2e-11  11%  1dusA  [c.66.1.4] MJ0882
    8e-11  26%  2p7hA1 [c.66.1.41] HYPOTHETICAL PROTEIN A:21 -- 249
    1e-10  19%  2b25A1 [c.66.1.13] HYPOTHETICAL PROTEIN A:6 -- 329
    2e-10  23%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    4e-10  20%  1nv8A  [c.66.1.30] HEMK PROTEIN
    1e-09  19%  1wznA1 [c.66.1.43] SAM-DEPENDENT METHYLTRANSFERASE A:1 -- 251
    2e-09  18%  1ws6A1 [c.66.1.46] METHYLTRANSFERASE A:15 -- 185
    3e-09  13%  1y8cA  [c.66.1.43] S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE
    4e-09  16%  1qamA  [c.66.1.24] ERMC' METHYLTRANSFERASE
    4e-09   9%  1o9gA  [c.66.1.29] RRNA METHYLTRANSFERASE
    8e-09  19%  1im8A  [c.66.1.14] YECO
    8e-09  23%  2avnA1 [c.66.1.41] UBIQUINONE/MENAQUINONE BIOSYNTHESIS A:1 -- 246
    9e-09  24%  1i1nA  [c.66.1.7] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    1e-08  15%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    1e-08  12%  2avdA1 [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE A:44 -- 262
    3e-08  20%  1ufkA  [c.66.1.39] TT0836 PROTEIN
    3e-08  22%  1xtpA  [c.66.1.42] LMAJ004091AAA
    1e-07  18%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    9e-07  27%  1ne2A  [c.66.1.32] HYPOTHETICAL PROTEIN TA1320
    9e-07  18%  1h1dA  [c.66.1.1] CATECHOL-O-METHYLTRANSFERASE
    1e-06  23%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    1e-06  20%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    2e-06  21%  1wy7A1 [c.66.1.32] HYPOTHETICAL PROTEIN PH1948 A:4 -- 204
    7e-06   9%  1eg2A  [c.66.1.11] MODIFICATION METHYLASE RSRI
    1e-05  18%  1qyrA  [c.66.1.24] HIGH LEVEL KASUGAMYCIN RESISTANCE PROTEIN
    4e-05  21%  1t43A  [c.66.1.30] PROTEIN METHYLTRANSFERASE HEMK
    8e-05  19%  1u2zA  [c.66.1.31] HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-79
    1e-04  21%  1p91A  [c.66.1.33] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
    1e-04  18%  1inlA  [c.66.1.17] SPERMIDINE SYNTHASE
    2e-04  15%  2esrA1 [c.66.1.46] METHYLTRANSFERASE A:28 -- 179
    2e-04  18%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    2e-04  14%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    2e-04  17%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    3e-04  14%  1fp2A2 [c.66.1.12] ISOFLAVONE O-METHYTRANSFERASE A:109 -- 352
    4e-04  29%  1l9kA  [c.66.1.25] RNA-DIRECTED RNA POLYMERASE
    4e-04  29%  1ri1A  [c.66.1.34] MRNA CAPPING ENZYME
    5e-04  16%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    6e-04  18%  1jsxA  [c.66.1.20] GLUCOSE-INHIBITED DIVISION PROTEIN B
:418

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKVVLNFTDEAAMQEIAADPALKLAEMYMEGRAKVA
1kp9A           ----------------------------------------------------------------------
2o57A1          ----------------------------------------------------------------------
1nkvA           ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1dctA           ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2ar0A1          ----------------------------------VAKLWKLCDNLRDGGVSYQNYVNASLLFLKXCKETG
1vl5A           ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1wxwA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1uwvA2          ----------------------------------------------------------------------
1vlmA           ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
2frnA1          ----------------------------------------------------------------------
2i6gA1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1ve3A1          ----------------------------------------------------------------------
1zq9A1          ----------------------------------------------------------------------
1i4wA           ----------------------------------------------------------------------
2ckdA1          ----------------------------------------------------------------------
1yb2A1          ----------------------------------------------------------------------
1dl5A1          ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2gh1A1          ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1vbfA           ----------------------------------------------------------------------
1xxlA           ----------------------------------------------------------------------
2fpoA1          ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1nv8A           ----------------------------------------------------------------------
1wznA1          ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1y8cA           ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1o9gA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
1i1nA           ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
2avdA1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1xtpA           ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1ne2A           ----------------------------------------------------------------------
1h1dA           ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1wy7A1          ----------------------------------------------------------------------
1eg2A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
1inlA           ----------------------------------------------------------------------
2esrA1          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1fp2A2          ----------------------------------------------------------------------
1l9kA           ----------------------------------------------------------------------
1ri1A           ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1jsxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNVAHHYDLSAKLFDLFLDEDWQ
1kp9A           -------------------------------------------------------LSDDFFRLFLDPTQT
2o57A1          ----------------------------------------------KDNAEIYYDDDDSYFHVWGGEDIH
1nkvA           ----------------------------------------------------------------------
2ex4A1          --------------------------------------------EVIEDEKQFYSKAKTYWKQIPPTVDG
1dctA           ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2ar0A1          QEAEYLPEGYRWDDLKSRIGQEQLQFY--------RKXLVHLGEDDKKLVQAVFHNVSTTITEPKQITAL
1vl5A           ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1wxwA2          -----------------------------PQVAEALRPHVQSVLAKNDARTRELEGLPLYVRPLLGEVPE
1bhjA           -------------------------------------------------------------------ADG
1uwvA2          --------------------------------------EGLDLYLAPDSEILETVSGEXPWYDSNGLRLT
1vlmA           --------------------------------------------------------------------WH
1uirA           ------------------------------------------------MERVIASGKTPFQDYFLFESKG
1yzhA1          ----------------------------------------------------------------------
2bzgA1          -------------------------------------------------VQKNQVLTLEEWQDK------
1qzzA2          -------------------------------------------------VSHADLAFTGLLDVVRTEDLS
2h00A1          -----------------------------------NFKDPEAVRATCTLLREDFGLSIDIPLERLIP---
2frnA1          ------------------------------HRIAEVYAEVLGV---KTVLRKGYELLYG--SDTVTVHVE
2i6gA1          ----------------------------------------------------------------------
1xdzA           --------------------------------------------------PRQLEQFELYYDMLVEWNEK
1ve3A1          ----------------------------------------------------------------------
1zq9A1          ----------------------------------------------------------------------
1i4wA           ---------------------------------------------------------------ISKLKFF
2ckdA1          ----------------------------------------------------------------------
1yb2A1          ----------------------------------------------------------------------
1dl5A1          --------------------------------------------------------------EFLTKSYP
1sqfA2          -------------------------WQSIVEANNQRPPMWLRINRTHHSRDSWLALDEAGMKGFPHADYP
2f8lA1          ----------------------------------------------------------------------
2gh1A1          ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
1e50A           ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1vbfA           -------------------------------------------------VDRSLFLPEN-LKDYAYAHTH
1xxlA           ----------------------------------------------------------------------
2fpoA1          ----------------------------------------------------------------------
1dusA           ------------------------------------------------------------VKIVEDILRG
2p7hA1          ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1nv8A           ----------------------------------------------------------------------
1wznA1          -------------------------------------------------MYELYTLLAEYYDTIYRRRIE
1ws6A1          ----------------------------------------------------------------------
1y8cA           ----------------------------------------------------CYNKFAHIYDKLIRADVD
1qamA           ----------------------------------------------------------------------
1o9gA           ---------------------------------------------------------------SSDLACG
1im8A           ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
1i1nA           --------------------------------------------------------TDKVFEVMLRSHYA
1pqwA           ----------------------------------------------------------------------
2avdA1          -----------------------------------------------SRSMREHPALRSLRLLTLEQPQ-
1ufkA           ----------------------------------------------------------------------
1xtpA           ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1ne2A           ----------------------------------------------------------------------
1h1dA           ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1wy7A1          ----------------------------------------------------------------------
1eg2A           -----------------------YFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLN
1qyrA           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1u2zA           ----------------------------------------------RQRIIDHLETIDKIPRSFIHDFLH
1p91A           ----------------------------------------------------------------------
1inlA           --------------------------------------------------------------FALDGITM
2esrA1          ----------------------------------------------------------------------
1lluA2          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1fp2A2          ----------------------------------------------------------------------
1l9kA           ----------------------------------------------------------------------
1ri1A           ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1jsxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIGSGWGGMAMYIAESAGADVTGITLSEEQLRV
1kp9A           YSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
2o57A1          VGLYKEPVDQDEIREASLRTDEWLASELVLQRQAKGLDLGAGYGGAARFLVRKFGVSIDCLNIAPVQNKR
1nkvA           ---------HRIHNPFTEEKYATLGRVLRXKPGTRILDLGSGSGEXLCTWARDHGITGTGIDXSSLFTAQ
2ex4A1          MLGGYGH----ISSIDINSSRKFLQRFLRKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQ
1dctA           ----------------------------------NLISLFSGAGGLDLGFQKAGFRIICANEYDKSIWKT
2dulA1          EGKAKILIPPVFYNPRMALNRDIVVVLLNILNPKIVLDALSATGIRGIRFALETPAEVWLNDISEDAYEL
2ar0A1          VSNXDS---LDWQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVHRAFIGLELVPGTRRL
1vl5A           ------------------SDLAKLXQIAALKGNEEVLDVATGGGHVANAFAPFVK-KVVAFDLTEDILKV
1pjzA           -------------HQSEVNKDQQYWSSLNVVPGARVLVPLCGKSQDMSWLSG-QGYHVVGAELSEAAVER
1wxwA2          RVQVQEGRVRYLVDLRAAYLDQRENRLYXEFRGERALDVFSYAGGFALHLAL-GFREVVAVDSSAEALRR
1bhjA           EAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEE-GFSVTSVDASDKMLKY
1uwvA2          FSPRDFIQVN---AGVNQKXVARALEWLDVQPEDRVLDLFCGXGNFTLPLATQ-AASVVGVEGVPALVEK
1vlmA           IFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVEP------------
1uirA           FGKVLILDKDVERDEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKPTVEKAVMVDIDGELVEV
1yzhA1          -----------QYVVLNPLEAKAKWRDLFGNDNPIHVEVGSGKGAFVSGXAKQNDINYIGIDIQKSVLSY
2bzgA1          ---WVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEXKWFAD-RGHSVVGVEISELGIQE
1qzzA2          ADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAER
2h00A1          -------TVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGTLNGWYFLATEVDDMCFNY
2frnA1          NGIKYKLDVAKIXFSPANVKERVRXAKVA-KPDELVVDXFAGIGHLSLPIAVYGKAKVIAIEKDPYTFKF
2i6gA1          -----------------------LAAAXVVAPGR-TLDLGCGNGRNSLYLAA-NGYDVTAWDXNPASXAN
1xdzA           INLTSITEKK-EVYLKHFYDSITAAFYVDFNQVNTICDVGAGAGFPSLPIKICFPHLVTIVDSLNKRITF
1ve3A1          YRVFPTYTDINSQEYRSRIETLEPLLXKYXKKRGKVLDLACGVGGFSFLLEDYGF-EVVGVDISEDXIRK
1zq9A1          ---------------------NSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKA-KKVVACELDPRLVAE
1i4wA           YGFKYLWNPT---VYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRYSLLEKRSSLYKF
2ckdA1          ------------YQAVRTNFFDTYFNNAVIDGIRQFVILASGLDSRAYRLDWPTGTTVYEIDQPKVLAYK
1yb2A1          ------------------------------RPGXDILEVGVGSGNXSSYILYALNGTLTVVERDEDNLKK
1dl5A1          LSYVYEDIVLVSSTSSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKVVSVEYSRKICEI
1sqfA2          DAVRLETPAPVGWVTVQDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEQVVAVDIDEQRLSR
2f8lA1          --------------SIGFIVAYLLEKVIQKKKNVSILDPACGTANLLTTVINQLELHASGVDVDDLLISL
2gh1A1          ------------------------------TKPVHIVDYGCGYGYLGLVLXPPEGSKYTGIDSGETLLAE
1m6yA2          --------------RHIPVXVREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCPCRIIGIDVDSEVLRI
1f38A           -----------------------IXCLAEPGKNDVAVDVGCGTGGVTLELAGRVRR-VYAIDRNPEAIST
1aqiA1          ---------------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHGTGFVGVEIDPKALDL
1e50A           ----------------------------------------------------------------------
1suiA1          -----------NIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPGKILAMDINKENYEL
1vbfA           EALPI----LPGINTTALNLGIFXLDELDLHKGQKVLEIGTGIGYYTALIAE-IVDKVVSVEINEKXYNY
1xxlA           -------------------------------AEHRVLDIGAGAGHTALAFSP-YVQECIGVDATKEXVEV
2fpoA1          ---------------TDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEXDRAVSQQ
1dusA           KKLKFKTDSGVFSYGKVDKGTKILVENVVVDKDDDILDLGCGYGVIGIALA-DEVKSTTXADINRRAIKL
2p7hA1          ----------------------------------NLLELGSFKGDFTSRLQE-HFNDITCVEASEEAISH
2b25A1          ----------------------MILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQVISFEVRKDHHDL
1o54A           ---------------------SFIAMMLDVKEGDRIIDTGVGSGAMCAVLARAVGSSVFAYEKREEFAKL
1nv8A           -------------------------------GIKTVADIGTGSGAIGVSVAKFSDAIVFATDVSSKAVEI
1wznA1          R------------VKAEIDFVEEIFKEDAKREVRRVLDLACGTGIPTLELAE-RGYEVVGLDLHEEMLRV
1ws6A1          --------------------------RLRYPRRGRFLDPFAGSGAVGLEAA-SEGWEAVLVEKDPEAVRL
1y8cA           Y--------------KKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCP-KFKNTWAVDLSQEXLSE
1qamA           ---------------------DKIMTNIRLNEHDNIFEIGSGKGHFTLELVQ-RCNFVTAIEIDHKLCKT
1o9gA           VVLHSAPGYPAFPVRLATEIFQRALARLPGDGPVTLWDPCCGSGYLLTVLGLLHRRQVIASDVDPAPLEL
1im8A           ----------------------------FVTADSNVYDLGCSRGAATLSARRNPNVKIIGIDNSQPXVER
2avnA1          -------------------------------NPCRVLDLGGGTGKWSLFLQE-RGFEVVLVDPSKEXLEV
1i1nA           KCNPYMDSPQSIGFQATISA-PHMHAYALEHEGAKALDVGSGSGILTACFARMVGCTVIGIDHIKELVDD
1pqwA           ------------FGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVAAVSIAKMIGARIYTTAGSDAKREM
2avdA1          -----------GDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALAADGRVVTCEVDAQPPEL
1ufkA           -------------------------------PGDKVLDLGTGSGVLAIAAEK-LGGKALGVDIDPMVLPQ
1xtpA           ---------------------RNFIASLPGHGTSRALDCGAGIGRITKNLLTKLYATTDLLEPVKHXLEE
1yb5A2          ------------------------------KAGESVLVHGASGGVAACQIARAYGLKILGTAGTEEGQKI
1ne2A           ----------------------STAAYFLIEGGRSVIDAGTGNGILACGSYLLGAESVTAFDIDPDAIET
1h1dA           ---------------------------------SLVLELGAYCGYSAVRMARLLGARLLTMEMNPDYAAI
1ixkA           -----------GLIYIQEASSXYPPVALDPKPGEIVADXAAAPGGKTSYLAQLXRNDIYAFDVDENRLRE
1a9xA3          ------------------------------TDIKSILILGAGPVIGQACEFDYSGAQAC-KALREEGYRV
1wy7A1          --------------------------------GKVVADLGAGTGVLSYGALLLGAKEVICVEVDKEAVDV
1eg2A           GNSLERVGHPTQKPAAVI----ERLVRALSHPGSTVLDFFAGSGVTARVAIQ-EGRNSICTDAAPVFKEY
1qyrA           ---------------------DSIVSAINPQKGQAMVEIGPGLAALTEPVGE-RLDQLTVIELDRDLAAR
1t43A           ------------------------ALARLPEQPCRILDLGTGTGAIALALAERPDCEIIAVDRMPDAVSL
1u2zA           YTRSHPQANKLKHYKAFSNYLSDVYQQCQLKKGDTFMDLGSGVGALECGCALSFGCEIMDDDLTILQYEE
1p91A           --------------------RDAIVAQLRDDKATAVLDIGCGEGYYTHAFADAPEITTFGLDVSKVAIKA
1inlA           TTEK-----DEFMYHEMLA---HVPMFLHPNP-KKVLIIGGGDGGTLREVLKHDSVEAILCEVDGLVIEA
2esrA1          --------------------------------GGRVLDLFAGSGGLAIEAVSRGXSAAVLVEKNRKAQAI
1lluA2          ------------------------------RPGQWVAISGIGGLGVAVQYARAMGLHVAAIDIDDAKLEL
1pgjA2          -----------------------------------VVGLGVMGANLALNIAE-KGFKVAVFNRTYSKSEE
1p9oA           -----RFAARLGAQGRRLVTSGGTKVPLEARPVRFLDNFSSGRRGATSEAFLAAGYGVLFLYRARSAFPY
1fp2A2          ---------------SKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICE-TFPKLKCIVFDRPQ---
1l9kA           ------------------AKLRWFVERNLVTPEGKVVDLGCGRGGWSYYCGLKNVREVKGLTK-------
1ri1A           -----------------------------TKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSIND
1a71A2          ------------------------------TQGSTCAVFGLGGAGVIMGCKAAGAARIIGVDINKDKFAK
1jsxA           -------------------------------QGERFIDVGTGPGLPGIPLSVRPEAHFTLLDSLGKRVRF


                         .         .         .         +         .         .         .:280
query           SRDRAAKRGLAGNVRFELQDYRYLPASKKYDRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIG
1kp9A           VQQLVANSENLRSKRVLLAGWEQF--DEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTIT
2o57A1          NEEYNNQAGLADNITVKYSFLEIPCEDNSYDFIWSQDAFLHS--PDKLKVFQECARVLKPRGVXAITDPX
1nkvA           AKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAG--GFAGAEELLAQSLKPGGIXLIGEPY
2ex4A1          AKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDNM
1dctA           YESNHSAKLIKGDISKISSDEFPKCDGIIGGPPCQSWSEGGSLRGIDDPRGKL---------FYEYIRIL
2dulA1          MKRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAERPFGSPMEFLDTALRSAKRRGILGVTATD
2ar0A1          ALXNCLLHDIEGNLDHGGAIRLGNTLGSKAHIVATNPPFGSATSNKQLCFXQHIIETLHPGGRAAVVVPD
1vl5A           ARAFIEGNGHQQVEYVQGDAEQXPFTDERFHIVTCRIAAHHFP--NPASFVSEAYRVLKKGGQLLLVDNS
1pjzA           YFTERGEQPHITSQGDFKVYAAPGIEIGHCAAFYDRAAMIALPADMRERYVQHLEALMPQACSGLLITLE
1wxwA2          AEELEANAFDLLRRLEKEGERFDLVLDPPAFAKGKKDVERAY--RAYKEVNLRAIKLLKEGGILATASCS
1bhjA           ALKERWNKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHGDQSEHRLALKNIASMVRPGGLLVIDHRN
1uwvA2          GQQNARLNGLQNVTFYHENLEEDVTKQPWAKNGFDKVLLDP--ARAGAAGVXQQIIKLEPIRIVYVSCNP
1vlmA           SERXAEIARKRGVFVLKGTAENLPLKDESFDFALXVTTICF--VDDPERALKEAYRILKKGGYLIVGIVD
1uirA           AKRHMPEWHQGAFDDPRAVLVIDDATEERYDVVIIDLTDPVGELLYTVEFYRLVKAHLNPGGVMGMQTGM
1yzhA1          ALDKVLEVGVPNIKLLWVDGSDLTDYFEDGESDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDN
2bzgA1          FFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSGALVAINPGDRKCYADTXFSLLGKKFQYLLCVLS
1qzzA2          ARRRFADAGLADRVTV-AEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRA
2h00A1          AKKNVEQNNLSDLIKVVKVPQKTLESEIIYDFCMCNPPFFGITEIMAEGGELEFVKRIIHDSLQLKKRLR
2frnA1          LVENIHLNKVEDRXSAYNXDNRDFPGENIADRILXGYVV------RTHEFIPKALSIAKDGAIIHYHNTV
2i6gA1          LERIXAAEGLD-NLQTDLVDLNTLTFDGEYDFILSTVVXXFLEAQTIPGLIANXQRCTXPGGYNLI----
1xdzA           LEKLSEALQL-ENTTFCHDRAETFGQRKDVRESYDIVTARA--VARLSVLSELCLPLVKKNGLFVALKAA
1ve3A1          AREYAKSRE-SNVEFIVGDARKLSFEDKTFDYVIFIDSIVHFEPLELNQVFKEVRRVLKPSGKFIXYFTD
1zq9A1          LHKRVQGTPV-ASKLQVLVGDVLKTDLPFFDTCVANLPYQIS--SPFVFKLLLHRPFFRCAILMFQREFA
1i4wA           LNAKFEGSPLQILKRDP---YDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLS
2ckdA1          STTLAEHGVTPTADRWPPALRSAGFDPSARTAWLAEGLLMYLPATAQDGLFTEIGGLSAVGSRIAVETSP
1yb2A1          AXDNLSEFYDIGNVRTSRSDIADFISDQXYDAVI------------------------------------
1dl5A1          AKRNVERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEV--------PETWFTQLKEGGRVIVLKLS
1sqfA2          VYDNLKRLGMKATVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSE
2f8lA1          ALVGADLQRQ--KXTLLHQDGLANLLVDPVDVVISDLPVGY--YPDDENAKTFELCREEGHSFAHFLFIE
2gh1A1          ARELF--RLLPYDSEFLEGDATEIELNDKYDIAICHAFLLH--XTTPETXLQKXIHSVKKGGKIICFEPH
1m6yA2          AEEKLKEFSDRVSLFKVSYREADFLGIEKVDGILXDLGVSTYQLKGLKEFLKKAEDLLNPGGRIVVISFH
1f38A           TEXNLQRHGLGDNVTLXEGDPEALCKIPDIDIAVVGGSGG-----ELQEILRIIKDKLKPGGRIIVTAI-
1aqiA1          PPWAEGILAD--FLLWEPGEAFDLIGNPPYGIVKAVKDLYKKAFSLYGAFLEKAVRLLKPGGVLVFVVPA
1e50A           -----------------------LVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
1suiA1          GLPVIKKAGVDHKIDFREGPALPVLDEMIKDEK-NHGSYDFIDKDNYLNYHKRLIDLVKVGGVIGYDNTL
1vbfA           ASKLLSYYNNIKLILGDGTLGYEEEKP--YDRVVVWATAPT--------LLCKPYEQLKEGGIXILPIGV
1xxlA           ASSFAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAAHHF--SDVRKAVREVARVLKQDGRFLLVDHY
2fpoA1          LIKNLATLKAGNARVVNSNAXSFLAKGTPHNIVFVDPPFRRG-LLEETINLLEDNGWLADEALIYVEVEN
1dusA           AKENIKLNNLDNYDIRVVHSDLYENVKDRKYNKIITNPPIRAGKEVLHRIIEEGKELLKDNGEIWVVIQT
2p7hA1          -----AQGRLKDGITYIHSRFEDAQLPRRYDNIVLTHVLEHI----------------------------
2b25A1          AKKNYKHWRDSWKLSHVEEWPDNVDFIHKD---ISGATFDAVDMLNPHVTLPVFYPHLKHGGVCAVYV--
1o54A           AESNLTKWGLIERVTIKVRDISEGFDEKDVDALF-------LDVPDPWNYIDKCWEALKGGGRFATNQVQ
1nv8A           ARKNAERHGVSDRFFVRKGEFLEPFKEKSIEMILS-----------------------------------
1wznA1          ARRKAKERN-LKIEFLQGDVLEIAFKNEFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPC
1ws6A1          LKENVRRTGLGARVVAEVFLPEAKAQGERFT---------------------------------------
1y8cA           AENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFNSYY
1qamA           TENKLV---DHDNFQVLNKDILQFKPKNQSYKIFG-----------------------------------
1o9gA           AAKNLALLSPA-GLTARELERREQSETAEGGALPCAIRTADV--FDPRALSAVLAGSAPDVVLTDLPYGE
1im8A           CRQHIAAYHSEIPVEILCNDIRHVE-IKNASXVILNFTLQFLPPEDRIALLTKIYEGLNPNGVLVL----
2avnA1          AREKGVKNVVEAKA----EDLPF--PSGAFEAVLALGVLSYV--ENKDKAFSEIRRVLVPDGLLIA----
1i1nA           SVNNVRKDDPSGRVQLVVGDGRMGYAEAPYDAIHVGAAAPVV--------PQALIDQLKPGGRLIL----
1pqwA           LSRLGVEYVG---------DSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKK
2avdA1          GRPLWRQAEAEHKIDLRLALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVL
1ufkA           AEANAKRNGVRPRFLEGSLEAAL--PFGPFDLLVANLYAE-----LHAALAPRYREALVPGGRALLTGIL
1xtpA           -----AKRELAGVGKFILASXETALPPNTYDLIVIQWTAIYLTDADFVKFFKHCQQALTPNGYIFF----
1yb5A2          VLQNGAHEVF---------NHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSR
1ne2A           AKRN------CGGVNFXVADVSEI--SGKYDTWI------------------------------------
1h1dA           TQQMLNFAGLQDKVTILNGA--SQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLL------
1ixkA           TRLNLSRLGVLNVILFHSSSLHIGELNVEFDKIL------------------------------------
1a9xA3          INVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLEVTMIG
1wy7A1          LIENLGE--FKGKFKVFIGD--VSEFNSRVDIVIXNPPFGSQRKHADRPFLLKAFEISD-----VVYSIH
1eg2A           YQKQLTF---------------------------------------------------------------
1qyrA           LQTHPF---LGPKLTIYQQDAMTFNFGELAE---------------------------------------
1t43A           AQ-RNAQHLAIKNIHILQSDWFSALAGQQFAMIVS-----------------------------------
1u2zA           LKKRCKLYGMRLNVEFSLKKS-------------------------------------------------
1p91A           AAKRYP------QVTFCVASHRLPFSDTSXDAIIRIYAPCKA----------------------------
1inlA           ARKYLKQTSCGFDAEIVIANAEYVRKFKEFDVIIIDSLFT-------EEFYQACYDALKEDGVFSAET--
2esrA1          IQDNIIXTKAENRFTLLKXEERAIDLTGRFDLVF-------LDPPYAKETIVATIEALAAKN--------
1lluA2          ARK------LGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAI----GMARRGGTIALVGLP
1pgjA2          FMKANASAPFAGNLKAFETMEAFAASLKKPRKA----LILVQAGAATDSTIEQLKKVFEKGDILVDTGNA
1p9oA           AHRFPPQTPLSGLLSLEAEENAFAEALRSYQEAAAAGTFLVVEFTTLADY--------------------
1fp2A2          ---VVENLSGSNNLTYVGGDMFSIP---NADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKMVIDKKK
1l9kA           ----------------------------------------------------------------------
1ri1A           ARVRARNMKRRFKVFFRAQDGRHMDLGKEFDVISSQFSF------HYDIAQRNIARHLRPGGYFI-----
1a71A2          AKEVGATECVNPQDYKKPIQEVLTEMSNGGVDF----SFEVIG--RLDTMVTALSCCQEAYGVSVIVGVP
1jsxA           LRQVQHELKLE-NIEPVQSRVEEFPSEPPFDGVIS-----------------------------------


                         .         *         .         .         .         .         +:350
query           QPYPALATNPFIEKYIFPGGYIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVAL
1kp9A           GLHPFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIAL
2o57A1          KEIDKSSIQPILDRIKLH--DXGSLGLYRSLAKECGLVTLRTFSRPDSLVHHYSKVKAELIKRSSEIASF
1nkvA           WRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYDVVEXVLADQAKWLTXRRWLEANPDDDRAELNI
2ex4A1          AQ-------EGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFAL----------
1dctA           KQKKPIFFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIILLNANDYGVAQDRKRVFYIGFRKELNIN
2dulA1          GAPLCRACLRKYLAVPLRGELCGTRILVGVIARYAAKYDLGIDVILAHYFRAFVKLKDGARK--------
2ar0A1          NVLFEGGKGTDIRRDLXDKCHLHTILRLPTGIFYAQGVKTNVLFFTKGTVANPNQDKNCTDDVWVYDLRT
1vl5A           APEVFYNYVEKERDYSHHRAWKKS--DWLKXLEEAGFELEELHCF--HKTFIFEDWCDRXNVTTEKKQEL
1pjzA           YDPPFSVPQTWLHRVMSGNWEVTKVGGQDTLHSSARGLKAGLERMDEHVYVLER----------------
1wxwA2          HHXTEAXVAEAAQDAHRLLRVVEKRGQP------------------------------------------
1bhjA           YDYILSTGCAPPGKNIYYKSDLTKDITT-----SVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLS
1uwvA2          ----------------------------------------------------------------------
1vlmA           RESFLREYEKNKEKVFYKNARFFSTEELXDLXRKAGFEEFKVVQTLFKHPSELSEIEPV--------KEG
1uirA           ILLRVHPVVHRTVREAF----------------------RYVRSYKNHIPGFFLNFGFLLASDAFDPAAF
1yzhA1          RGLFEXKLNGVWLDLHASDFEGNVXTEYEQKFSNKGQVIYRVE---------------------------
2bzgA1          YDYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEK--------LYLLTE-------------
1qzzA2          DRF--FSTLLDLRMLTFMGGRVRTRDE-------------------------------------------
2h00A1          -------------WYSCMLGKKCSLAPLKEELRIQGVKVTYTEFCQGRTMRWALAWS-------------
2frnA1          EKLXPREPFETFKRITKEYGYDVEKLNE------------------------------------------
2i6gA1          ----------------------------------------------------------------------
1xdzA           AEEELNAGKKAITTLGGELENIHSFKLPIEESDRNIMVIRKIKNTPKKYPRK------------------
1ve3A1          LRELKEISKVIPDQEERTVVIEFSFRVRFNVWGKTGVELLAKLYFTKEAEEKVGNYSYLTVYNP------
1zq9A1          LRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPFVRKNKTLSAAFKSS
1i4wA           CIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIE
2ckdA1          LHVSDALGFEQAVDVQELIYHDENRAVVADWLNRHGW--RATAQSAPDEMRRVGRWGDGVPMADDKDAFA
1yb2A1          ----------------------------------------------------------------------
1dl5A1          RRQPAFKKDPLVGNYKLETRFITAGGNL------------------------------------------
1sqfA2          I-------LDAIWPHLKTGGTLVLPEENSLQIKAFLQRTADAELCETPEQPGKQNLPGAE----------
2f8lA1          QGXRYTKPGGYLFFLVPDAXFGTSDFAKVDKFIKKNGHIEGIIKLPETLFKSQARKSILILEKADVDVKP
2gh1A1          WISNGVLQKLFESDTQRNGKDGNIGXKIPIYLSELGVKNIECRVSSNXHHNDKNDLYQSLKEEGIAGDPG
1m6yA2          SLEDRTFRNSKKLRILTEKPVRPSEEEIRENPRARSGRLRAAE---------------------------
1f38A           ----------------------------------------------------------------------
1aqiA1          -TWLVLEDFALLREFLAREGKTS---VYYLGEVFPQKKVSAVVIRFQKSGKGLSLWDTQE-----SESGF
1e50A           NDNYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDG-------
1suiA1          NGSVVAPPDAPLRKYV------------------------------------------------------
1vbfA           GRKVIKKGNSPSLENLGEVXFGR-----------------------------------------------
1xxlA           AP-----EDPVLDEFV------------------------------------------------------
2fpoA1          GLPTVPANWSLHREKVAGQVAY------------------------------------------------
1dusA           KQGAKSLAKYNVETVTIKGGY-------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1o54A           ETLKKLQELPFIRIEVWE----------------------------------------------------
1nv8A           ----------------------------------------------------------------------
1wznA1          GPVVWNEQKGEEKLVIMDWREVEPAVQKLRFKRLVQILRPNGEVKAFLVDDELNIYTPREVRLLAEK-YF
1ws6A1          ----------------------------------------------------------------------
1y8cA           KLSQVLGNNDFNYENQFEDDLVSKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLG-----
1qamA           ----------------------------------------------------------------------
1o9gA           RTHWEGQVPGQPVAGLLR----------------------------------------------------
1im8A           ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
1i1nA           ----------------------------------------------------------------------
1pqwA           DVY-------------------------------------------------------------------
2avdA1          WRGKVL----------------------------------------------------------------
1ufkA           KD-----RAPLVREAMAGAGF-------------------------------------------------
1xtpA           ----------------------------------------------------------------------
1yb5A2          GTIE-INPRDTMAKES------------------------------------------------------
1ne2A           ----------------------------------------------------------------------
1h1dA           ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------
1a9xA3          ATADAI----------------------------------------------------------------
1wy7A1          LAKP--EVRRFIEKFSWEHGFVV-----------------------------------------------
1eg2A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1u2zA           ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
1inlA           ----------------------------------------------------------------------
2esrA1          ----------------------------------------------------------------------
1lluA2          PGDFPTPIFDVVLKGLIAGSIVGTRADLQEALDGEGL---------------------------------
1pgjA2          HFKDQGRRAQQLEAAGLRFLGMG-----------------------------------------------
1p9oA           ----------------------------------------------------------------------
1fp2A2          DENQVTQIKLLMDVNMACNGKERNEEEWKKLFIEAGF--QHYKISPLTGFLSL-----------------
1l9kA           ----------------------------------------------------------------------
1ri1A           ----------------------------------------------------------------------
1a71A2          PDSQNLSMNPML----------------------------------------------------------
1jsxA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           YDERFFRMWEFYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQxxxxxxxxxxxxxxxxxxxx
1kp9A           QSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK----------------------------------
2o57A1          FQANXKRGLEHWIEGGRAGKLTWGGXLFR---------------------------------------
1nkvA           APKRYVTYARECFGWGVFALI-----------------------------------------------
2ex4A1          --------------------------------------------------------------------
1dctA           YLPPIPHLIKPTFKDVIWDLKDNPIPALDKNKTNGNKCIYPNHEY-----------------------
2dulA1          GDETLEKLGYIYFDDKTGKFELEQGFLPT---------------------------------------
2ar0A1          NXPSFGKRTPFT--------------------------------------------------------
1vl5A           KSKPTEYYQKFKIVVEDGRVYSFRGESILXKARK----------------------------------
1pjzA           --------------------------------------------------------------------
1wxwA2          --------------------------------------------------------------------
1bhjA           YYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLK--------------------
1uwvA2          --------------------------------------------------------------------
1vlmA           YGEGAFVVIR----------------------------------------------------------
1uirA           SEGVIEARIRE--RNLALRHLTAPYLEAMFVLPKDLLEA-----------------------------
1yzhA1          --------------------------------------------------------------------
2bzgA1          --------------------------------------------------------------------
1qzzA2          --------------------------------------------------------------------
2h00A1          --------------------------------------------------------------------
2frnA1          --------------------------------------------------------------------
2i6gA1          --------------------------------------------------------------------
1xdzA           --------------------------------------------------------------------
1ve3A1          --------------------------------------------------------------------
1zq9A1          AVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQILTSTGFSDK-------------------------
1i4wA           EWDPILFSAAEIWPTKGKPIALVEMDPIDFD-------------------------------------
2ckdA1          EFVTAHRL------------------------------------------------------------
1yb2A1          --------------------------------------------------------------------
1dl5A1          --------------------------------------------------------------------
1sqfA2          --------------------------------------------------------------------
2f8lA1          PKEVLLNLSSLTDPSVTAPILAEIENWFK---------------------------------------
2gh1A1          DKQQFVERLIARGLTYDNAL------------------------------------------------
1m6yA2          --------------------------------------------------------------------
1f38A           --------------------------------------------------------------------
1aqiA1          TPILWAEYPH----------------------------------------------------------
1e50A           --------------------------------------------------------------------
1suiA1          --------------------------------------------------------------------
1vbfA           --------------------------------------------------------------------
1xxlA           --------------------------------------------------------------------
2fpoA1          --------------------------------------------------------------------
1dusA           --------------------------------------------------------------------
2p7hA1          --------------------------------------------------------------------
2b25A1          --------------------------------------------------------------------
1o54A           --------------------------------------------------------------------
1nv8A           --------------------------------------------------------------------
1wznA1          EKVKIYGNLKRELSPNDM--------------------------------------------------
1ws6A1          --------------------------------------------------------------------
1y8cA           --------------------------------------------------------------------
1qamA           --------------------------------------------------------------------
1o9gA           --------------------------------------------------------------------
1im8A           --------------------------------------------------------------------
2avnA1          --------------------------------------------------------------------
1i1nA           --------------------------------------------------------------------
1pqwA           --------------------------------------------------------------------
2avdA1          --------------------------------------------------------------------
1ufkA           --------------------------------------------------------------------
1xtpA           --------------------------------------------------------------------
1yb5A2          --------------------------------------------------------------------
1ne2A           --------------------------------------------------------------------
1h1dA           --------------------------------------------------------------------
1ixkA           --------------------------------------------------------------------
1a9xA3          --------------------------------------------------------------------
1wy7A1          --------------------------------------------------------------------
1eg2A           --------------------------------------------------------------------
1qyrA           --------------------------------------------------------------------
1t43A           --------------------------------------------------------------------
1u2zA           --------------------------------------------------------------------
1p91A           --------------------------------------------------------------------
1inlA           --------------------------------------------------------------------
2esrA1          --------------------------------------------------------------------
1lluA2          --------------------------------------------------------------------
1pgjA2          --------------------------------------------------------------------
1p9oA           --------------------------------------------------------------------
1fp2A2          --------------------------------------------------------------------
1l9kA           --------------------------------------------------------------------
1ri1A           --------------------------------------------------------------------
1a71A2          --------------------------------------------------------------------
1jsxA           --------------------------------------------------------------------