[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86566.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "2joeA1.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1bvrA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1vlwA.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "2bd0A1.bssp"
#ERROR : Can't open dsspfile "1e5lA2.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "1qp8A1.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1ftrA1.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "1pjqA1.bssp"

## Summary of PDB Search
:272
    4e-40  50%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    2e-31  17%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    2e-30  17%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    8e-30  29%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-26  12%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    2e-24  23%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    4e-24  26%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    7e-24  15%  2joeA1 [d.371.1.1] HYPOTHETICAL LIPOPROTEIN YEHR A:2 -- 131
    7e-24  24%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    1e-23  23%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    1e-23  30%  1bvrA  [c.2.1.2] PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP)
    2e-23  20%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    9e-23  22%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-22  21%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    1e-21  23%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    2e-21  23%  1xg5A  [c.2.1.2] ARPG836
    3e-20  18%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    6e-19  16%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    1e-18  20%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    9e-18  17%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    1e-17  16%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    1e-16   8%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    2e-16  13%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    2e-16  21%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    4e-16   7%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    2e-15  10%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    2e-15  15%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    2e-14  15%  1n5dA  [c.2.1.2] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    4e-14   8%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    5e-14   9%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    8e-14  17%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    3e-13  10%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    7e-13  22%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    4e-12  12%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    1e-11  11%  1a4uA  [c.2.1.2] ALCOHOL DEHYDROGENASE
    1e-11   7%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    5e-11  10%  1vlwA  [c.1.10.1] 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-
    1e-10  13%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    2e-10   9%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-10  16%  2bd0A1 [c.2.1.2] SEPIAPTERIN REDUCTASE A:2 -- 241
    2e-09  14%  1e5lA2 [d.81.1.2] SACCHAROPINE REDUCTASE A:125 -- 391
    2e-09  15%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    7e-09   9%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    8e-09  12%  1qp8A1 [c.2.1.4] FORMATE DEHYDROGENASE A:83 -- 263
    8e-09   6%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    2e-08  11%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    4e-08  11%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    2e-06   9%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    3e-06   9%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    1e-05  13%  1ftrA1 [d.58.33.1] FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN A:1
    1e-04  12%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    1e-04   9%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    2e-04   8%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    5e-04  12%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    8e-04  14%  1pjqA1 [c.2.1.11] SIROHEME SYNTHASE A:1 -- 113
:272

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELGAFMAGHCDVT
1c14A           -----GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVA
1bdbA           -------LKGEAVLITGGA--SGLGRALVDRFVAEGAKVAVLDAERLAELETDHGDNVLGIVGDVRSLED
1pwxA           -------------IVTNVK--HFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAET-----YPQLKPM
1ahhA           --------------------------------ATAGASVVVSINADAANHVVDEIQQLGGQAFACRCDIT
1nasA           ----ADGLGCAVCVLTGAS--RGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQPDLTEAG
1w6uA           ---PPNSFQGKVAFITG--GGTGLGKGMTTLLSSLGAQCVIARKMDVLKATAEQISSQTGNKVHAQCDVR
1zemA1          -------FNGKVCLVTGAG--GNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYCDVT
2joeA1          --------------------DKEESKKFSANLNGTEIAITYVYKGDKVLKQSSETKIQFAS-----IGAT
2gdzA1          -------VNGKVALVTGAAQ------GIGRAFAEAGAKVALVWNLEAGVQCKAALHEQFEPTLFIQCDVA
1h5qA           ----TISFVNKTIIVTGGN--RGIGLAFTRAVAAAGANVAVIYAADAVEVTEKVGKEFGVKTKAYQCDVS
1bvrA           ----TGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLDVQNEE
1a27A           --------ARTVVLITGCS--SGIGLHLAVRLASDPSQSFKVYDLKTQGRLWEAARALACPPGSLETLQL
1dohA           LGPQSASLEGKVALVTGAG--RGIGREMAMELGRRGCKVIVNNSTESAEEVVAAIKKNGSDAACVKANVG
2bgkA1          ----TNRLQDKVAIITGGAGG--IGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVT
2ag5A1          -----GRLDGKVIILTAAA--QGIGQAAALAFAREGAKVIAT---DINESKLQELEKYPGIQ-TRVLDVT
1xg5A           ---------DRLALVTGAS--GGIGAAVARALVQQGLKVVGCARTVG---NIEELAAECKSAGYPGCDLS
1yxmA1          ----PGLLQGQVAIVTGGA--TGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIP
1snyA           ----------NSILITGCN--RGLGLGLVKALPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLR
1ae1A           -------LKGTTALVTGGS--KGIGYAIVEELAGLGARVYTCRNEKELDECLEIWREKGLNVEGSVCDLL
1o5iA           -------IRDKGVLVLAAS--RGIGRAVADVLSQEGAEVTICARNEE--------------LLKRSGHRY
1zbqA1          --------------------------GALVVVNDLGGDFKGV---GKGSLAADKVVEEIRRRGGKVANYD
1u7uA           -------LKHLNIMITAGP--TREPLDPVRYISDHSSGKMGFAIAAAAARRVTLVSGPVSLPTPPFVKRV
1dhrA           ---------ARRVLVYGGR--GALGSRCVQAFRARNWWVASIDVVE------NEEASASVIVKMTDSFTE
1spxA           --------AEKVAIITGSS--NGIGRATAVLFAREGAKVTITRHAERLEETRQQILAAGVSEQNVNADVT
1u9jA           ----------TRVLILGVN--GFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFV---EGDIS
1lu9A1          ---AGGSVKGKKAVVL--AGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAADSVNKRFKVNVTAAETA
2fr0A1          ---------------------------IARWLARRGAPHLLLSRSGPDADGAGELVAELARTTVAACDVT
1n5dA           --------NTRVALVTGAN--KGIGFAIVRDLCRQFAGDVVLTDVARGQAAVKQLQAEGLSPRFHQLDII
2c54A1          -------SENLKISITGAG--GFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENC
2zqnA1          ----------------------------------------------------------------------
1yb1A           -------VTGEIVLITGAG--HGIGRLTAYEFAKLKSKLVLWINKHGLEETAAKCKGLGAKVHTFVVDCS
1jr2A           -------PEDYGGLIFTSPRA--VEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSDTEGE
1fjhA           -------------VISGCA--TGIGAATRKVLEAAGHQIVGIDIRDA----------------EVIADLS
1xseA           ------MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSME
1a4uA           -------LTNKNVIFVAAL--GGIGLDTSRELVKRNLKNFVILDRVENPTALAE------LKAINPKVNI
1vhcA           --------LKIVPVIALDN--ADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLRANRPDFLIAATVL
1vlwA           -------KHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLKEKGAIIGAGTVT
1h2iA           ---------------------------------------------EEYQAIQKALRQRLGPEYISSRMAG
1di6A           --------------LVSISDRDKGIPALEEWLTSALTTPFELET---------------------RLIPD
2bd0A1          -------------LITGAG--KGIGRAIALEFARAARHHPDFEPVLVLSSRTAADLEKIALTDTITADIS
1e5lA2          ----------------------------------------------------------------------
1yo6A1          -------MSPGSVVVTGAN--RGIGLGLVQQLVKDKNIRHIIATARDVEKATELKSIKDSRVHVLPLTVT
1x74A1          ----AGPLSGLR-VVELAG--IGPGPHAAMILGDLGADVVRIDRPI-----------SRDAMLRNRRIVT
1qp8A1          -------IQGEKVAVLGLGE---IGTRVGKILAALGAQVRGFTPKEGPWRFTNSLEEALREARAAVCALP
1nytA1          --------------------------GVLLPLLSLDCAVTITRTVSR---------------AEELAKLF
2ib0A1          ---ALAVEHATIYGYGIVS--ALSPPGVNFLVADALKQHRHRRDDIVMLSARGVTAPIAAAGYQLPMQVS
1rkxA           ----NSFWQGKRVFVTGHT--GFKGGWLSLWLQTMGATVKGYSLTAPTVPSLFETARVADGMQSEIGDIR
1a4iA1          IKETGVPIAGRHAVVVGRSKI--VGAPMHDLLLWNNATVTTCHHLDEEVNKGDILVVATGQPEMVKGEWI
1c3vA1          --------------------KGKVGTTMVRAVAAADDLTLSAE-------LDAGDPLSLLTDGNTEVVID
1ftrA1          -------------------NGVEIEDTFAEAFEAKMARVLITASHKWAMIAVKEATGFGTSVIMCPAEAG
2bkaA1          -------MQNKSVFILGAS--GETGRVLLKEILEQGLFSKVTLIGRRKLTF----------DEEAYKNVN
2hjsA1          ---------PLNVAVVGAT--GSVGEALVGLLDERDFPLHRLHLLASAESAGQRXGFAESSLRVGDVDSF
1edzA1          LLPEGNRLYGKKCIVINRSEIVGRPLAALLANDGATVYSV-----DVNNIQKFTRGESLKLNKHHVEDLG
1qycA           --------SRSRILLIGAT--GYIGRHVAKASLDLGHPTFLL---VRESTASSNSEKAQLLESFKASGAN
1pjqA1          -------LRDRDCLIVGGGD---VAERKARLLLEAGARLTVNTFIPQFTVWANEGMLTLVEGPFDETLAI


                         .         .         *         .         .         .         .:140
query           DLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTMDISVFSLAAVAKRAEPIMND
1c14A           EDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNP
1bdbA           QKQAASRCVARFGKIDTLIPNAGIWDYSTALV---DLPEESLDAAFDEVFHINVKGYIHAVKACLPALVA
1pwxA           SEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKY---AVEDYRGAVEALQIRPFALVNAVASQMRK
1ahhA           SEQELSALADFAISKLGKVDILVNNAGGGG-----PKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMNG
1nasA           VQRLLSAVRELPRPEGLQRL-LLINNAATLGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFGL
1w6uA           DPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLS----PNAWKTITDIVLNGTAFVTLEIGKKAQK
1zemA1          SEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAF---APVQDYPSDDFARVLTINVTGAFHVLKAVSRQMIT
2joeA1          TKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINVSAEDAQMELVMKA
2gdzA1          DQQQLRDTFRKVVDHFGRLDILVNNA---------GVNNEKNWEKTLQINLVSVISGLGLDYMSKQNGGE
1h5qA           NTDIVTKTIQQIDADLGPISGLIANAGVSVVK----PATELTHEDFAFVYDVNVFGVFNTCRAVAKLWKQ
1bvrA           HLASLAGRVTEAIGAGNKLDGVVHIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
1a27A           DVRDSKSVAAARERTEGRVDVLVCNAGLG----LLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMRG
1dohA           VVEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVK----DVTPEEFDRVFTINTRGQFFVAREAYKHLEI
2bgkA1          KDEDVRNLVDTTIAKHGKLDIMFGVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKK
2ag5A1          KKKQIDQFAN----EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMN-LNVRSMYLMIKAFLPKMLAQKS
1xg5A           NEEDILSMFSAIRSQHSGVDICINNAGLAR----PDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMVD
1yxmA1          IQCNIRNEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMK
1snyA           NFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPK-SARITAVRSQELLDTLQTNTVVPIXLAKACLPLLKK
1ae1A           SRTERDKLMQTVAHVFGKLNILVNNAGVVIH----KEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKA
1o5iA           VVCDLRKDLDLLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGW-
1zbqA1          SVEEGEKVVKTALDAFGRIDVVVNNAGILRD----RSFARISDEDWDIIHRVHLRGSFQVTRAAWEKKQK
1u7uA           DVMTALEMEAAVNASVQQQNIFIGCAAVADY----RAALTIKMVKNPDIVAGVAALKDHRPYVVGFAAET
1dhrA           QADQVTAEVGKLLGDQKVDAILCVAGGWAGG----NAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKE
1spxA           TDAGQDEILSTTLGKFGKLDILVNNAGQSIES-----------YDATLNLNLRSVIALTKKAVPHLSSTK
1u9jA           IHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCS
1lu9A1          DDASRAEAVKGAHFVFTAGAIGLELL---------PQAAWQNESSIEIVADYNAQPPLGIGGIDATDKEY
2fr0A1          DRESVRELLGGIGDDVPLSAVFHAAATLDDGDTLTG-------ERIERASRAKVLGARNLHELTRELDLT
1n5dA           DLQSIRALCDFLRKEYGGLDVLVNNAAIAFQ----LDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKP
2c54A1          LKVTEGVDHVFNLAADMGGMGFIQS----NHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEKQ
2zqnA1          -----------------------------------------------------YIKSELNGKVLDIEGPA
1yb1A           NREDIYSSAKKVKAEIGDVSILVNNAGVVY----TSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMKN
1jr2A           TCGNAEKLAEYCSRESSALPLLFPCGNLKREILPKALKDKGSITVYQTVAHPGIQGNLNSYYSQVPASIT
1fjhA           TAEGRKQAIADLAKCSKGMDGLVLCAGLGPQTKVLGNVVSVNYFGATELMDISSVASAHLAFDKNPLAEE
1xseA           DMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQG-
1a4uA           TFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFKRKGGP
1vhcA           TAEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNFPITPGVNNPXAIEIAL-------------EXGISAV
1vlwA           SVEQCRKAVESGAEFIVSPHLDEEISQFCKEK----GVFYMPGVMTPTELVKAMKLGHTILKLFQFVKAM
1h2iA           GGQKVCYIEGHRVINLANEMFGYNGWAHSIT-----QQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHGY
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVT-------PDATLAVADREMPGFGEQMRQISLHFVP
2bd0A1          DMADVRRLTTHIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSG
1e5lA2          -------TIEEVHAAGGKIKTFLSYCG-------GLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYK-
1yo6A1          CDKSLDTFVSKVGEIVGSDSLLINNAGVLLSYGTNTEPNRAVIAEQLDVNTTSVVLLTAASKESGDQLSV
1x74A1          ADLKSDQGLELALKLIAKADVLIEGYRP-------GVTERLGLGPEECAKVNDRLIYARMTGWGQTGPQQ
1qp8A1          LNKHTRGLVKYQHLALXAEDAVFVNVGR----AEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAFS
1nytA1          AHTGSIQALSMDELEGHEFDLIINATSSGISGDIP----AIPSSLIHPGIYCYDMFYQKGKTPFLAEQRG
2ib0A1          SAADAARLAVRMNDGATAWRAVVEHAETADDRVFAST--ALTESAVMATRWNRVLGAWPITA--------
1rkxA           DQNKLLESIR----EFQPEIVFHMAAQPLVRLSYSEPVETYSTNVMGTVYLLEAIRHVGGVKAVVNITSD
1a4iA1          KPGAIVIDCGINYKVVGDVAYDEAKERAS----FITPVPGGVGPMTVAMLMQSTVE--------------
1c3vA1          FTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAERPGL
1ftrA1          IDCGYVPPEETPDGRPGVTIMIGHNDEDELKEQLLDRIGQC-----------------------------
2bkaA1          QEVVDFEKLDDYASAFQGHDVGFCCLGTTR-----------GKAGAEGFVRVDRDYVLKSAEL----AKA
2hjsA1          DFSSVG----------------------------------------------------------------
1edzA1          EYSEDLLKKCSLDSDVVITGVPSE----------NYKFPTEYIKEGAVCINFACTKNFSDDVKEKASLPM
1qycA           IVHGSIDDHASLVEAVKNVDVVISTV---------GSLQIESQVNIIKAI------------KEVGTVKR
1pjqA1          AATDDDTVNQRVSDAAESRRIFCN----------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDLGNRGIRVNAVSAGPIKTLAASGIGDFRYIL
1c14A           GSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKML
1bdbA           RGNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELA-PYVRVNGVGSGGINSDLRGPSSLGPLAD
1pwxA           SGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSYPTEPWKTNPEHV
1ahhA           GGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIE-
1nasA           SKTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEE--PSVRVLSYAPGPLDNDMQQLASKDPELR
1w6uA           GAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT-----LDPTGTFE
1zemA1          QNYIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGSQYFSTDPKVVA
2joeA1          AG--------------------------------------------------------------------
2gdzA1          GGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSLAANLMNSGVRLNAICPGFVNTAILESIEKEENMG
1h5qA           QKGSIVVTSSMSSQIILTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIR--
1bvrA           GGSIVGMDFDPSRAMPAYNW-MTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGE
1a27A           SGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTLDRTDIHTFHRFY
1dohA           GRLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPN
2bgkA1          GSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFSSRVEE
2ag5A1          GNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNP
1xg5A           DGHIININSMSGHRVLPLTHFYSATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLHD-----
1yxmA1          EHGGSIVNIIVPTKAFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWSFF
1snyA           IINXSSILGSIQGNTDGGXYAYRTSKSALNAATKSLSVDLYPQRIXCVSLHPGW----------------
1ae1A           NGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVIL---------QKEEI
1o5iA           -GRIVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKELLSEEKK-
1zbqA1          YGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPED----
1u7uA           NNVEEYARQKRIRKNLDLICANSDNNALHLFWQDGDKV--------------------------------
1dhrA           GGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDT----------PMN
1spxA           GEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVAT-------GFYSTM
1u9jA           DKYFDEDHSNLIVGPVNKPRWIYSVKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRA
1lu9A1          GGKRAFGALIGGLKLRACIAKLFESSEGVFDAEEIYKL--------------------------------
2fr0A1          --AFVLFSSFASAFGAPGLGGYAPGNAYLDGLAQQRRSDGLPATAVAWGTWAGSG----------MAEGP
1n5dA           QGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLAGDKILLNACCPGWVRTMGGPKAPKSPEVG
2c54A1          LETTNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFG-------------
2zqnA1          PGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKR--AWIVSGNTIAQ
1yb1A           NHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAATGVKTTCLCPNFVNT-------------
1jr2A           FFSPSGLTYSLKHIQELSGDNIDQIKFAAIG--PTTARALAAQGLPVSCTAESPTPQ-------------
1fjhA           AKARAIVEHAGEQGGNLAYAG---SKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP-------------
1xseA           --SIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTIYLGPASPKEECA
1a4uA           GGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVE
1vhcA           KFFPAEASGGVKXIKALLGPYAQLQIXPTGGIGLHNIRDYLAIPNIVACGGSWFVEK-------------
1vlwA           KGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVKGTPDEVREKAKAFV-----------------
1h2iA           GVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCIL-DKDYLRSLNKLPRQL-------------
1di6A           TAILSR-QVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYV-------
2bd0A1          HIFFITSVAA--TKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGKVDD-----
1e5lA2          DGKVTNVAGPELMATAKPYFIYP--GFAFVAYPNRDSTPYKERYQIPEADNIVR-GTLRYQGFPQFIKVL
1yo6A1          SRAAVITISSTSGSAQFPVLAYRMSKAAINMFGRTLAVDLKDDNVLVVNFCPGWVEQSTAELISSFNKLD
1x74A1          AGHDINYISLNGILHAIGRGDERPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGKGQVVDAAMVDGSS
1qp8A1          LPNVVATPWVAG----------------------------------------------------------
1nytA1          SKRNADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEEL------------------------------
2ib0A1          ----------------------------------------------------------------------
1rkxA           KDNKEWIWGYRENEAMGGYDPYSNSKGCAELVTSSYRNSFFNPANYGQHGTAVAT---------------
1a4iA1          ----------------------------------------------------------------------
1c3vA1          TVGLEPLL--------------------------------------------------------------
1ftrA1          ----------------------------------------------------------------------
2bkaA1          GGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEEL------KFDRYSVFRPGVLLCDRQESRPGEWLVR
2hjsA1          ----------------------------------------------------------------------
1edzA1          TGKVT-----------------------------------------------------------------
1qycA           FFPSEFGNDVDNVHAVEPAKSVFEVKAKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGLTAPPRDKVV
1pjqA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KWNEYNAPLKRTVTIEEVGKSALYLLSDLSTAVTGEIHHVDSGYHTIGMKAVDAPDISVVxx
1c14A           AHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAM-------------
1bdbA           MLKSVLPI-GRMPEVEEYTGAYVFFATGDAAPATGALLNYDGGLGVRGFSGAGGNDL-----
1pwxA           AHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMI---------------
1ahhA           QKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG-------------------
1nasA           SKLQKLKSDGALVDCGTSAQKLLGLLQKDT-FQSGAHVDFY---------------------
1w6uA           KEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLR------
1zemA1          QQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG-------------------
2joeA1          --------------------------------------------------------------
2gdzA1          QYIEYKDHIKGILDPPLIANGLITLIED--DALNGAIMKITTS-------------------
1h5qA           DHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQL-----------------
1bvrA           EAGAQIQLGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQLL-------------
1a27A           QYLAHSKFREAAQNPEEVAEVFLTALRAPK--PTLRYFTTERFLPLLRMRLDDPSGSNYV--
1dohA           GEAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGAC-----------------
2bgkA1          LAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTA--------
2ag5A1          EEARNRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWS-----------------
1xg5A           KDPEKAAATYECLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTG-------------------
1yxmA1          EGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTH-SYEVPDH-----
1snyA           -VKTDXGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPL-----------------
1ae1A           DNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG--------------
1o5iA           KQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGGLSKFPL-------------
1zbqA1          --------LVEALKPEYVAPLVLWLCHE-SCEENGGLFEVGAGW------------------
1u7uA           --------------------------------------------------------------
1dhrA           RKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTT-------------------
1spxA           ATMKECVPAGVMGQPQDIAEVIAFLADKTSSYIIGHQLVVDGGSSLI---------------
1u9jA           ITQLILNQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEEL----------
1lu9A1          --------------------------------------------------------------
2fr0A1          VADRFRRHGVIEMPPETACRALQNALDRAEVCPIVIDVRWDRFLLAYTAQRPTR--------
1n5dA           A----ETPVYLALLPSDAEGPHGQFVTDKKVVEWG---------------------------
2c54A1          --------------------------------------------------------------
2zqnA1          LSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQK-----------------------------
1yb1A           --------------------------------------------------------------
1jr2A           --------------------------------------------------------------
1fjhA           -------PMGRRAEPSEMASVIAFLMSPAASYVHGAQIVIDGGI------------------
1xseA           LEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNW------------------
1a4uA           PRVAELLLSHPTQTSEQC---GQNFVKAIEANKNGAIWKLDLGT------------------
1vhcA           --------------------------------------------------------------
1vlwA           --------------------------------------------------------------
1h2iA           --------------------------------------------------------------
1di6A           --------------------------------------------------------------
2bd0A1          ------EMQALMMMPEDIAAPVVQAYLQPSRTVVEEI-------------------------
1e5lA2          VSDEEQPFLKEAIPWKEATQKIVKASSASEQDIVSTI-------------------------
1yo6A1          NSHN-GRFFMRNLKPYE---------------------------------------------
1x74A1          VLIQMWTDTRGANMLDGGAPYYDTYECADGRYVAVGAIE-----------------------
1qp8A1          --------------------------------------------------------------
1nytA1          --------------------------------------------------------------
2ib0A1          --------------------------------------------------------------
1rkxA           --------------------------------------------------------------
1a4iA1          --------------------------------------------------------------
1c3vA1          --------------------------------------------------------------
1ftrA1          --------------------------------------------------------------
2bkaA1          KFFGSLPASGHSVPVVTVVRAMLNNVVR--PRDKQMELLENKAIHDLG--------------
2hjsA1          --------------------------------------------------------------
1edzA1          --------------------------------------------------------------
1qycA           ILGDGN-ARVVFVKEEDIGTFTIKAVDD-PRTLNKTLYLRLPANTL----------------
1pjqA1          --------------------------------------------------------------