[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86654.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1n2fA.bssp"
#ERROR : Can't open dsspfile "1nyeA.bssp"
#ERROR : Can't open dsspfile "2onfA1.bssp"
#ERROR : Can't open dsspfile "1ml8A.bssp"
#ERROR : Can't open dsspfile "1lqlA.bssp"
#ERROR : Can't open dsspfile "2oplA1.bssp"
#ERROR : Can't open dsspfile "2d7vA1.bssp"

## Summary of PDB Search
:140
    3e-37  59%  1n2fA  [d.227.1.1] ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN
    2e-32  25%  1nyeA  [d.227.1.1] OSMOTICALLY INDUCIBLE PROTEIN C
    1e-30  23%  2onfA1 [d.227.1.1] HYPOTHETICAL PROTEIN TA0195 A:1 -- 139
    1e-26  13%  1ml8A  [d.227.1.2] HYPOTHETICAL PROTEIN (CRP REGION)
    1e-24  18%  1lqlA  [d.227.1.1] OSMOTICAL INDUCIBLE PROTEIN C LIKE FAMILY
    1e-17  21%  2oplA1 [d.227.1.1] HYPOTHETICAL PROTEIN A:4 -- 185
    2e-17  19%  2d7vA1 [d.227.1.1] HYPOTHETICAL PROTEIN VCA0330 A:7 -- 161
:140

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLGALKAVAGKHK
1n2fA           IKALYTATATATGGRDGRAVSSDGVLDVKLSTPREMGGQGGAATNPEQLFAAGYSACFIGAMKFVAGQRK
1nyeA           MTIHKKGQAHWEGDIKGTVSTESGVLNQQPYGFNTRFEGEK-GTNPEELIGAAHAACFSMALSLMLGEAG
2onfA1          ---VYESDVSWIDDRRT--EVSVGDHRIEVDSPPEFGGPEG-QLYPETLFPSVLASCLLTTFLEFKDRXG
1ml8A           ------ARVKWVEGLTFLGESASGHQ-----ILMDGNSGDK-APSPMEMVLMAAGGCSAIDVVSILQKGR
1lqlA           MDKKYDITAVLNEDSSMTAISDQF----QITLDARPKHTAK-GFGPLAALLSGLAACELATANLMAPAKM
2oplA1          --FKFRATNQWXGGTHNQATIKDFYGVFDLDEPPVLLGENR-GANPVEYLLVALSGCLTTSLVAHAAARG
2d7vA1          -RKDSEAFTDNQYSRAHTWEFDGGSKILASASPHVVLSVEA-NVDPEEAFVAALSSCHXLVFLSIAAKQR


                         .         .         *         .         .         .         .:140
query           VKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAHIVCPYSHAMRTSTEVPVSVA
1n2fA           QTLPADASITGKVGIGQ--IPGGFGLEVELHINLPGMEREAAEALVAAAHQVCPYSNATRGNIDVRLNVS
1nyeA           FTP-TSIDTTADVSLDKVDAGFAIKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQL-
2onfA1          INLKSNSHVTAELGPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAXQLAEKYCFISRAIRNNVEEIVDY-
1ml8A           QD-VVDCEVKLTSERRERL---FTHINLHFIVTGRDLKDAAVARVDLSAEKYCSVALMLEKAVNITHSY-
1lqlA           ITI-NKLLMNVTGSRSTNPTDGYFGLEINLHWEIHSNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINV-
2oplA1          IA-LRGVKSRYEGDIDLREVPVGYREIRVFFSIDADLTDGQKEELIRXAQKYSPVYNTVAKPVPVAVLL-
2d7vA1          YLVE-SYTDNAVGILGKNSKGTSVTVVLRPQVVFSGPTLQQLEKXHHLAHENCFIANSVETEVVT-----