[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86734.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1wybA1.bssp"
#ERROR : Can't open dsspfile "1ei5A3.bssp"
#ERROR : Can't open dsspfile "1ci8A.bssp"
#ERROR : Can't open dsspfile "1blsA.bssp"
#ERROR : Can't open dsspfile "1cefA.bssp"
#ERROR : Can't open dsspfile "2dnsA1.bssp"
#ERROR : Can't open dsspfile "1tvfA2.bssp"
#ERROR : Can't open dsspfile "1xp4A2.bssp"

## Summary of PDB Search
:435
    2e-35  29%  1wybA1 [e.3.1.1] 6-AMINOHEXANOATE-DIMER HYDROLASE A:5 -- 392
    1e-31  15%  1ei5A3 [e.3.1.1] D-AMINOPEPTIDASE A:3 -- 335
    2e-28  21%  1ci8A  [e.3.1.1] PROTEIN (CARBOXYLESTERASE)
    9e-22  15%  1blsA  [e.3.1.1] BETA-LACTAMASE
    8e-21  18%  1cefA  [e.3.1.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE
    9e-19  15%  2dnsA1 [e.3.1.1] D-AMINO ACID AMIDASE A:2 -- 363
    5e-10  10%  1tvfA2 [e.3.1.1] PENICILLIN BINDING PROTEIN 4 A:15 -- 315
    9e-06   9%  1xp4A2 [e.3.1.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE A:25 -- 293
:435

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMQGFPPPEDKIIRFSDSDYFNFPKSRWTVCHFRQL
1wybA1          -----------------------------------PARYPGAAAGEPTLDS--WQEPPHNRWAFAHLGEM
1ei5A3          ----------------------------------------------------------------------
1ci8A           ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1cefA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------
1tvfA2          ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           MPTVNVSRGLGAPAALERKLDPAMDAVTFRPTGADQDMTWLQSLSANYTDGIVVLHKGVLVYERYSGCLN
1wybA1          VPSAAVSRRPGHALGAIAAQLPDLEQRLEQTYTD----------------AFLVLRGTEVVAEYYRAGFA
1ei5A3          ---------------------------------------------------VAVVKDGEVVLQHAWGFAD
1ci8A           ---------------------------------------------------AIVARHGEILYRRAQGLAD
1blsA           ---------------------------------------------------VAVIYQGKPHYYTFGKADI
1cefA           ------------------------------DLPAPDDTGLQAVLHTALSQGARVDDNGTIHQLSEGVADR
2dnsA1          --------------------------------------GILDDHVARGVVGVSLALPGEETSLYQSGYAD
1tvfA2          ---------------------QATNSDVTPVQAANQYGYAGLSAAYEPTSAVNVSQTGQLLYQY-----N
1xp4A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EAGQHGAMSVTKSLTGLLGEMLVAEGTLDENAKVATVVPELEKSAFGDATIRQVLDMTTGLRYSEDYADP
1wybA1          PDDRHLLMSVSKSLCGTVVGALVDEGRIDPAQPVTEYVPELAGSVYDGPSVLQVLDMQISIDYNESEV--
1ei5A3          LRTRTPICSVSKQFTCAVLLDAVGEPELLDDALEAYLDKFEDE----RPAVRDLCNNQSGLRDYWALSVL
1ci8A           REAGRPMASVTKPIVALAVLRLVARGELALDAPVTRWLPEFRPRLADGSTIHHLLTHTSGLGYWLLEGAG
1blsA           AANKFELGSISKTFTGVLGGDAIARGEISLDDAVTRYWPQLTGKQWQGIRMLDLATYTAGGLPLQVPDEV
1cefA           ATGRFRVGSVTKSFSAVVLLQLVDEGKLDLDASVNTYLPGLLPD--DRITVRQVMSHRSGLYD-------
2dnsA1          KFNKMPMASCTKSFIATGLHLLVQDGTVDLDEPITRWFPDLPKA--AQMPVRILLNHRSGLPDFE-----
1tvfA2          IDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTNKEYIMSTLPELSNTKL----------------
1xp4A2          --------SITKLITVYLVYEALENGSITLSTPVDISDYPYQLTTNSEASNIPXEARNYTVEELLEATLV


                         .         .         .         +         .         .         .:280
query           NADVWIYSAAGNPLPKPDGYEGPRSYFDYLKTVVKQGENGSAFGYKTINSDALGWVIARASGKSVAELLS
1wybA1          ------QTHGRSAGWRTRRHGDPADTYEFLTTLRGD-GSTGEFQYCSANTDVLAWIVERVTGLRYVEALS
1ei5A3          CGADP-----------EGVFLPAQAQSLLRRLKTTHFEPGSHYSYCNGNFRILADLIEAHTGRTLVDILS
1ci8A           SVYDRLGISDGIDLRDFD----LDENLRRLASAPLSFAPGSGWQY-SLALDVLGAVVERATGQPLAAAVD
1blsA           T--------------------DNASLLRFYQNWQPQWKPGTTRLYANASIGLFGALAVKPSGMPYEQAMT
1cefA           YTNDMFAQTVPGFESVRNKVFSYQDLITLSLKHGVTNAPGAAYSYSNTNFVVAGMLIEKLTGHSVATEYQ
2dnsA1          ----------TSMPMISDKSWTAQEIVDFSFRHGVQKEPWHGMEYSNTGYVLAGMIIAHETGKPYSDHLR
1tvfA2          --------YPGQVWTIAD-------LLQITVSNSSNAAALILAKKVSKNTSDFVDLMNNKAKAIG---MK
1xp4A2          SSANSAAIALAEKI-----------------------------AGSEKDFVDXXRAKLLEWGIQDATVVN


                         .         *         .         .         .         .         +:350
query           QRIWSRIGAEQDAYYTVDSTGTPFAGGGLNAGLRDMARIGQLLLDDGMAGGHRLIPQKAIDNIRHGGDKA
1wybA1          TYLWAKLDADRDATITVDTTGFGFAHGGVSCTARDLARVGRMMLDGGVAPGGRVVSEDWVRRVLAGGSHE
1ei5A3          ERIFAYEGDTVRGFLPATNRIQWMGDAGICASLNDMIAWEQFID------ATRDDESGLY--------RR
1ci8A           ALVAQPLGMRDCGFVSAEPERFAVPYHDGQPEPVRMRDGIEVPLPEGHGAAVRFAPSRVFEPGAYADDVL
1blsA           TRVLKPLKLDHTWINVVSPGMLDAQAYGVKTNVQDMANWVMANMAPENVADASLKQGIALAQSRYWRIGS
1cefA           NRIFTPLNLTDTFYVTEQTVSWAQSAGAVISSTQDLDTFFSALMSGQLMSAAQLAQMQQWTTVNSTQGYG
2dnsA1          SRIFAPLGMKDTWVGTHETFPIEREARGYMHAAADDENPQWDVSGAGDPVDGVWDSTEWFPLSGANAAGD
1tvfA2          NTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKET----PKILDFTKQLAPTTHAVTY
1xp4A2          TTGLNNETLGDNIYPGS------KKDEENKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAGXTITSTN


                         .         .         .         .         *         .         .:420
query           AFAKGGYPALRGWSYRAMWWVTHNANGAFMARGVHGQAIYVDPAADMVIARFSSHPVASNAANDPTSLPA
1wybA1          ATDKGFTNTFPDGSYTRQWWCTGNERGNVSGIGIHGQNLWLDPLTDSVIVKLSSWPDPDTEHWHRLQNGI
1ei5A3          LSGPQTFKDGVAAPYGFGLNLHETGGGHGGALRGWRCQRWHCADERLSTIAMFNFEGGASEVAFKLMNIA
1ci8A           RALEGAETRGPGWGFGYLSAVLDDPAGTLQWGGVYGHSWFVDRALGLSVL------LLTNTAYEGMSGPL
1blsA           MYQGLGWEMLNWPVEANTVVVKASWVHKTGSTGGFGSYVAFIPEKQIGIVMLANTSYPNPARVE------
1cefA           L----------GL-RRRDLSCGISVYGHTGTVQGYYTYAFASKDGKRSVTALANTSNNVNVLNT------
2dnsA1          MVSPAFFPGSNTVANGHGLLLMRYGSGHLGQIPGHTSIMGRDEETGAALMLIQGAGDFESFYLKGVNEPV
1tvfA2          ----YTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRINQVIMGAGDYKNLGGEKQRNMMG
1xp4A2          YX--------LEGXPAYRGGFDGLKTGTTDKAGESFVGTTVEKGXRVITVVLNADH---QDNNPYARFTA


                         .         .         +         .         .         .         .:490
query           YEAVARYLMGxxxxx
1wybA1          LLDVSRAL-------
1ei5A3          LGVSS----------
1ci8A           TIALRDAVYA-----
1blsA           ---------------
1cefA           ---------------
2dnsA1          DRVLE----------
1tvfA2          NALMERSF-------
1xp4A2          TSSLXDYIS------