[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK86736.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bg1A1.bssp"
#ERROR : Can't open dsspfile "2o3iA1.bssp"
#ERROR : Can't open dsspfile "2c5wB1.bssp"
#ERROR : Can't open dsspfile "2oluA2.bssp"
#ERROR : Can't open dsspfile "2oluA1.bssp"
#ERROR : Can't open dsspfile "1gytA1.bssp"
#ERROR : Can't open dsspfile "1mwrA3.bssp"
#ERROR : Can't open dsspfile "1nrfA.bssp"
#ERROR : Can't open dsspfile "1m6kA.bssp"
#ERROR : Can't open dsspfile "1xa1A.bssp"
#ERROR : Can't open dsspfile "1es2A.bssp"
#ERROR : Can't open dsspfile "1xp4A2.bssp"
#ERROR : Can't open dsspfile "1k25A4.bssp"
#ERROR : Can't open dsspfile "1blsA.bssp"
#ERROR : Can't open dsspfile "1wybA1.bssp"
#ERROR : Can't open dsspfile "1alqA.bssp"
#ERROR : Can't open dsspfile "1e25A.bssp"
#ERROR : Can't open dsspfile "1e3uA.bssp"
#ERROR : Can't open dsspfile "2dnsA1.bssp"

## Summary of PDB Search
:757
    4e-55  19%  2bg1A1 [e.3.1.1] PENICILLIN-BINDING PROTEIN 1B A:337 -- 789
    7e-53  12%  2o3iA1 [e.73.1.1] HYPOTHETICAL PROTEIN A:2 -- 390
    1e-52  25%  2c5wB1 [e.3.1.1] PENICILLIN-BINDING PROTEIN 1A B:266 -- 650
    3e-50  18%  2oluA2 [e.3.1.1] PENICILLIN-BINDING PROTEIN 2 A:293 -- 692
    2e-47  34%  2oluA1 [d.2.1.10] PENICILLIN-BINDING PROTEIN 2 A:68 -- 292
    7e-29  13%  1gytA1 [c.50.1.1] CYTOSOL AMINOPEPTIDASE A:1 -- 178
    1e-28  20%  1mwrA3 [e.3.1.1] PENICILLIN-BINDING PROTEIN 2A A:328 -- 668
    3e-28  18%  1nrfA  [e.3.1.1] REGULATORY PROTEIN BLAR1
    2e-26  15%  1m6kA  [e.3.1.1] BETA-LACTAMASE OXA-1
    2e-24  13%  1xa1A  [e.3.1.1] REGULATORY PROTEIN BLAR1
    1e-23  13%  1es2A  [e.3.1.1] DD-TRANSPEPTIDASE
    2e-23  10%  1xp4A2 [e.3.1.1] D-ALANYL-D-ALANINE CARBOXYPEPTIDASE A:25 -- 293
    1e-20  21%  1k25A4 [e.3.1.1] LOW-AFFINITY PENICILLIN-BINDING PROTEIN 2X A:264
    8e-18  10%  1blsA  [e.3.1.1] BETA-LACTAMASE
    6e-12  10%  1wybA1 [e.3.1.1] 6-AMINOHEXANOATE-DIMER HYDROLASE A:5 -- 392
    8e-12  16%  1alqA  [e.3.1.1] CP254 BETA-LACTAMASE
    2e-10  18%  1e25A  [e.3.1.1] EXTENDED-SPECTRUM BETA-LACTAMASE PER-1
    1e-04  24%  1e3uA  [e.3.1.1] BETA-LACTAMASE OXA-10
    5e-04  13%  2dnsA1 [e.3.1.1] D-AMINO ACID AMIDASE A:2 -- 363
:757

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bg1A1          ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxDALTFGTAGSIVLLALAMPAFEETKKDWRYRGDFAVTFLDRYGNTIGHRGI
2bg1A1          ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2oluA1          -------------------------------------------------------KIYDKNGELVKTDNG
1gytA1          -------------------GSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQ
1mwrA3          ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IHEDSVPIDQMPDHFIKAVLATEDRRFFDHFGIDFIGLARAMSENARAGGVVQGGSTLTQQLAKNLFLTN
2bg1A1          ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2oluA1          QRHEHVNLKDVPKSXKDAVLATEDNRFYEHGALDY-------------GFGSEGASTLTQQVVKDAFLS-
1gytA1          T----LLLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKG--RNN
1mwrA3          ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERSLERKIKEAFLALWLESNMSKKEILSLYLDRAYMXXXXXXXXXXXXXXXXKNLTDVTLSESAILAGLF
2bg1A1          ----------------------------------------------------------------------
2o3iA1          ----------------------------------------------------------------------
2c5wB1          ----------------------------------------------------------------------
2oluA2          ----------------------------------------------------------------------
2oluA1          ---IGRKAQEAYLSYRLEQEYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLP
1gytA1          YWKVRQAVETAKETLYFDQLKTNKSEPRRPLRKMVF----------------------------------
1mwrA3          ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KAPAKYAPHVNLPAARARANTVLSNLVQSGLMTEGQVIGARRNPATVIDRADVKAPDYFLDWAFDEVQRL
2bg1A1          -----------------------------YFTTLAEAQERMYDY--LAQRDNVSAK-ELKNEATQKFYRD
2o3iA1          ----------------------------------------------------------------------
2c5wB1          --------------------------------------------------------PAYMDNYLKEVINQ
2oluA2          -----------------------------------------------------SEYNSYVNFVKSELXND
2oluA1          QVPNNYNIYDHPKAAEDRKNTVLYLXHYHKRITDKQWEDAKKID--------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          ----------------------------------------------------------------------
1nrfA           ----------------------------------------------------------------------
1m6kA           ----------------------------------------------------------------------
1xa1A           ----------------------------------------------------------------------
1es2A           ----------------------------------------------------------------------
1xp4A2          ----------------------------------------------------------------------
1k25A4          ----------------------------------------------------------------------
1blsA           ----------------------------------------------------------------------
1wybA1          ----------------------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           ----------------------------------------------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAEGKFKDHTVVVRTTIDTGLQQAAEQAMEMELREYGEGYRVKQGAMVMIENGGGVRAMVGGRDYGESQF
2bg1A1          LAAKEIENGGYKITTTIDQKIHSAMQSAVADYGYLLDDGTGRVEVGNVLMDQTGAILGFVGGRNYQENQN
2o3iA1          -----------------------------------------------------SDLEPLLQGACFARHLA
2c5wB1          VEEETGYNLLTDVYTNVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGKVIAQLGARHQVSFGI
2oluA2          ENLGNVLQSGIKIYTNXDKDVQKTLQNDVDNGSFYKNKD---QQVGATILDSKGGLVAISGGRDFKDVVN
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          ----------------IDAKVQKSIYNNXK-----------NDYGSGTAIHQTGELLALVSTPSYSNEEY
1nrfA           ------------------------------------GTNVEYEDYSTFFDKSASGGFVLFNSNRKKYTIY
1m6kA           ---------------------------------------TDISTVASPLFETEGCFLLYDASTNAEIAQF
1xa1A           ---------------------------------------YQILDKSKIFGSNSGSFVMYSMKKDKYYIYN
1es2A           ---------------------------------------PTIAAVGGYAMNN-----------GTGTTLY
1xp4A2          ---------------------------------------FTIAAKHAIAVEA-----------NTGKILY
1k25A4          ---------------TLSSPLQSFMETQMDAFLEKVKG----KYMTATLVSKTGEILATTQRPTFDFVWR
1blsA           --------------------SEKQLAEVVANTITPLMKAQSVP-GMAVAVIYQGKPHYYTFGKADIAANK
1wybA1          -----------VSRRPGHALARLGAIAAQLPDLEQRLEQTY---TDAFLVLRGTEVVAEYYRAGFAPDD-
1alqA           ----------------------MKEFAAAAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRF-----
1e25A           ---------------------------LLKEQIESIVIGKKATVGVAVWGPDDLEPLLINPFEKF-----
1e3uA           --------------------------------------------------EAVNGVFVLCKSSSKSCATN
2dnsA1          --------------------LNNAIQGILDDHVARGVVG------VSLALCLPGEETSLYQSGYADKFNK


                         .         .         +         .         .         .         .:490
query           NRATAALRQPGSSFKVYTYSAAMEKGMKPDTLISDAPVTWRGWSPQNYGRSYAGKVTLQVALAKSYNTVP
2bg1A1          NHAFDTKRSPASTTKPLLAYGIAIDQGLSETILSNYPTNFANNPIMYANSKGTGMMTLGEALNYSWNIPA
2o3iA1          ANFRKGDYYPTDKVRVVDV-DEATDGDCVXVAYXGAPDAINQVQWPNGP--VEAALAARQRLESQGRKLA
2c5wB1          NQAVETNRDWGSTMKPITYAPALEYGVYEATIVHDEPYNYPGTPVYNWDRGYFGNITLQYALQQSRNVPA
2oluA2          RNQATDPHPTGSSLKPFLAYGPAIENWATNHAIQDESSYQDGSTFRNYDTKSHGTVSIYDALRQSFNIPA
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          NKLTEDKKEPGSTQKILTAXIGLNNKTDDKTSYKIDGKGWQKWGGYNVTRVVNGNIDLKQAIESSDNIFF
1nrfA           NRKESTSRAPASTYKVFSALLALESGITKNDSHMTWDGTQ------YPYKEWNQDQDLFSAMSSSTTWYF
1m6kA           NKAKCATQMPDSTFXIALSLMAFDAEI-----IDQKTIFKWDKTPKGM-EIWNSNHTPKTWMQFSVVWVS
1xa1A           EKESRKRYSPNSTYKIYLAMFGLDRHI------INDENSRMSWNHKHYFDAWNKEQDLNTAMQNSVNWYF
1es2A           TKAADTRRSTGSTTKIMTAKVVLAQSLNLDAKVTIQKAYSDYQAHLIVGDKVTVRQLLYGLMLPAGCDAA
1xp4A2          EKDATQPVEIASITKLITVYLVYNGSITLSTPVDISDYPYQLSNIPXEARNYTVEELLEATLVSSANSAA
1k25A4          DILYQSNYEPGSAMKVMTLASSIDNN------------TFPSGEYFNSS-------------ELSSNVGM
1blsA           PVTPQTLFELGSISKTFTGVLGG-DAIARGEISLDDAVT---RYWPQLTGKQWQGIRMLDLATYTAGGLP
1wybA1          ------RHLLMSVSKSLCGTVVGAGRIDPAQPVTEYVPELAGSVYDGQVLDMQISIDYNESEVQTHGRSA
1alqA           --------AYASTSKAINSAILLEQVPYKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTAN
1e25A           --------PMQSVFKLHLAMLVLHQVDQGKVIVNRAKVLQNTWAPIMKEFSVPVQQLLQYSVSHSDNVAC
1e3uA           DLARASKEYPASTFKIPNAIIGLETGIKNE----HQVFKWDGK-PRAM-KQWERDLTLRGAIQVSAVPVF
2dnsA1          MPMTGHLFRIASCTKSFI-ATGLHLLVQDGTVDLDEPIT-RWFPDLPKAAQMPVRILLNHRSGLPDFETS


                         *         .         .         .         .         +         .:560
query           VRLAKDVLGTQVIVDTAKAMGVATPLRSDKTIPLGTSEVTVLDQATAYAVFPADGMQSRRHGIEQVMDYE
2bg1A1          YWTYRML-RENGVDVKGYMEKMGPEYGIESLPMGGGIEVTVAQHTNGYQTLANNGVYHQKHVISKIEAAD
2o3iA1          YVVAPESAKLGLAVVDADGAGRAVPSLPXLTYAAAGVPPTPAFLAGESGLCVELGVRXPPPDREDISTVV
2c5wB1          VETLNKV-GLNRAKTFLNGLGIDYAISSNTTESDKKYGASSEKMAAAYAAFANGGTYYKPMYIHKVVFSD
2oluA2          LKAWQS-VKQNAGNDAPKKFAAKLGLNYEGVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRD
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          ARVALE-LGSKKFEKGXKKLGVGEDIILDNEILLADSLINPVQILSIYSALENNGNINAPHLLKDT----
1nrfA           QKLDRQI-GEDHLRHYLKSIHYEDFSVPADYWLDGSLQISPLEQVNILKKFYDNEFDFKQSNIETVKDSI
1m6kA           QEITQKI-GLNKIKNYLKDFDYGNQDFSGDERNESSLKISPEEQIQFLRKIINHNLPVKNSAIENTIEN-
1xa1A           ERISDQI-PKNYTATQLKQLNYGNLGSYKSYWMEDSLKISNLEQVIVFKNMMENHFSKKAKNQLSSS---
1es2A           YALADK-YGSGSTRAARVKSFIGTHFDSFDGIGNGANYSTPRDLTKIASSAMKNSTFR------------
1xp4A2          IALAEK-IAGSEKDFVDXXRAKLLEWGIQDATVVNTTGLNNETLGDNIYPGSKKDEENKLSAYDVAIVAR
1k25A4          SLLEQK-MGDATWLDYLKRFKFGVPLPADNIVSIAQSSVTQTQMLRAFTAIANDGVMLEPKFISAIYDTN
1blsA           LQVPDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIGLMPYEQAMTTRVLKPLKLDHTWINVPKAEEAH
1wybA1          GWRTRRHGDPADTYEFLTTLRGDGSTCSANTDVLAWIVERVTGLRYVEALAKLDADRDATITVDTTGFGF
1alqA           NKIIKEIGGIKKVKQRLKELGDKVTPVRYEIELNYYSPKSKKDTSTPAAF--------------------
1e25A           DLLFELVGGPAALHDYIQSMGIKTAVVANEAQMHADDQVQYQNWTSMKGAAEI-----------------
1e3uA           QQIAREV---------------------------------------------------------------
2dnsA1          MPMISDKSWTA-----------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           GNVLYDFSHDEPPAKRVLSEEANSKMNQMLVTIPVMGTARRGALDNGIVSGGKTGTSQAYRDAWYVGFTG
2bg1A1          GRVVY---EYQDKPVQVYSKATATIMQGLLREVLKSNLTSLNPTLANADWIGKTGTTNQDENMWLMLSTP
2o3iA1          EQXLRPILTNPQFGQFGGLAXWXXSPAQLGGALPVRGTLSRALKLGRALQDGKVKTAEAXL--DFLRREL
2c5wB1          GSEKEFS----NVGTRAMKETTAYMMTDMMKTVLTYGTGRN-AYLAWLPQAGKTGTSNVAPDELFAGYTR
2oluA2          GETIEYD----HTSHKAXSDYTAYXLAEXLKGTFKPYGSAYGHGVSGVNXGQYNLPDNAAKDVWINGFTP
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          --------KNKVWKKNIISKENINLLTDGXQQV-VNKTHKEDIYRSYANLIGKSGTAELKRQGWFISYDK
1nrfA           RLEES----------------------------------------NGRVLSGKTGTSVINGAGWFIGYVE
1m6kA           ----------------------------MYLQDLDNSTKL----------YGKTGAGFTANRGWFEGFII
1xa1A           ----------------------------LLIKKN-----------EKYELYGKTGTGIVYNNGWFVGYVI
1es2A           ----------TVVKTKAYTAKTVTKTGSIRTMDTWKNTNGLLSSYSGAI-GVKTGSGPEAKLVFAATRGG
1xp4A2          -----NLIKKYPQVLEITKKPSSTFAGXTI--TSTNYXLEGXPAYRGGFDGLKTGTTDKAGESFVGTTVE
1k25A4          NQSVR--KSQKEIVGNPVSKEAASTTRNHMILV---GTDPLIITVPGQNVAVKSGTAQIANGGYLVGSTN
1blsA           YAWGYGKAVRVSPGMLDAQAYGVKTNVQDMANWVMANMAPENVADASLKQQSRYWRIGSQGLGWEMLNWP
1wybA1          AHGGVSCTARDL--ARVGRMMLDGGVRRVLAGGSHEAMTDKGFTNTFPDGSYTRQWWCTGNERGNVSGIG
1alqA           GKTLNKLIANGK-----LSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAF--
1e25A           --------LKKFEQKTQLSETSQALLWKWMVETTTGPERLKGLLPAGTVVAHKTGTSQATNDLGIILLPD
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           NYTTAVWFGNDEFTPMNNMTGGALPAMTYKRLMDYAHQGMELRPIPxxxxxxxxxxxxxxxxxxxxxxxx
2bg1A1          RLTLGGWIGHDDNHSLSQQAGYSNNSNYMAHLVNAIQQASPSIWGN------------------------
2o3iA1          DIKGKLLFGPATLASPGKVGERRCTVLYQNESLLAWDSALSHPLAT------------------------
2c5wB1          KYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWN------------------------
2oluA2          QYTXSVWXGFSKVKQYGNSFVGHSQQEYPQFLYENVXSKISSRD--------------------------
2oluA1          ----------------------------------------------------------------------
1gytA1          ----------------------------------------------------------------------
1mwrA3          NXXXAINVKDVQ-DKGXASYNAKISGKVYDELYENG----------------------------------
1nrfA           TADNTFFFAVH--IQGEKRAAGSSAAEIALSILDK-----------------------------------
1m6kA           SKSGHKYVFALTGNLGSNLTSSIKAKKNAITILN------------------------------------
1xa1A           TNHDKYYFA---THLSDGKPSGKNAELISEKILK------------------------------------
1es2A           KTVIGTVLASTSIPARESDA---------TKIMNYGFA--------------------------------
1xp4A2          KVITVVLNADHQDNNPYARFTATSS---------------------------------------------
1k25A4          YIFSAVTMN-----PAEN----------------------------------------------------
1blsA           VEANTVVEGSD-----------------------------------------------------------
1wybA1          IHGQNLWLDPLT----------------------------------------------------------
1alqA           ----------------------------------------------------------------------
1e25A           GLLVAVFVKDSAES---SRTNEAIIAQVAQTAYQFELK--------------------------------
1e3uA           ----------------------------------------------------------------------
2dnsA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bg1A1          ---------------------------------------------------------
2o3iA1          ---------------------------------------------------------
2c5wB1          ---------------------------------------------------------
2oluA2          ---------------------------------------------------------
2oluA1          ---------------------------------------------------------
1gytA1          ---------------------------------------------------------
1mwrA3          ---------------------------------------------------------
1nrfA           ---------------------------------------------------------
1m6kA           ---------------------------------------------------------
1xa1A           ---------------------------------------------------------
1es2A           ---------------------------------------------------------
1xp4A2          ---------------------------------------------------------
1k25A4          ---------------------------------------------------------
1blsA           ---------------------------------------------------------
1wybA1          ---------------------------------------------------------
1alqA           ---------------------------------------------------------
1e25A           ---------------------------------------------------------
1e3uA           ---------------------------------------------------------
2dnsA1          ---------------------------------------------------------