[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87067.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fug41.bssp"
#ERROR : Can't open dsspfile "1cc1L.bssp"
#ERROR : Can't open dsspfile "2hthB1.bssp"
#ERROR : Can't open dsspfile "1jj2H.bssp"

## Summary of PDB Search
:396
    e-121  46%  2fug41 [e.18.1.2] NADH-QUINONE OXIDOREDUCTASE CHAIN 4 4:35 -- 409
    e-101  17%  1cc1L  [e.18.1.1] HYDROGENASE (LARGE SUBUNIT)
    8e-33  15%  2hthB1 [b.55.1.12] VACUOLAR PROTEIN SORTING PROTEIN 36 B:3 -- 131
    1e-24  16%  1jj2H  [d.41.4.1] RIBOSOMAL PROTEIN L10E
:396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQAVPYFDRLDY
2fug41          -----------------PSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDY
1cc1L           ---------KISIDPLTR-VEGHLKIEVEVKDGKVVDAKCS-GGMFRGFEQILRGRDPRDSSQIVQRICG
2hthB1          ----------------------VWTSGLLEINETLVIQQRGVRIYD-GEEKIKFDAGTLLLSTH--RLIW
1jj2H           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQAMDVGAMTPPVWGFEEREKLM
2fug41          LHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETIL
1cc1L           VCPTAHCTASVMAQDDAFGVKVTTNGRITRNLIFGANYLQSHILHAKADATNTYGLNQYLKALEIRRICH
2hthB1          RDQKNHECCMAILLSQIVFIEEQAAGIGKS----AKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGI
1jj2H           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPFLTVLDNIEGLLTDNRIYKQRNVDIGVVSLE
2fug41          DLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPE
1cc1L           EMVAMFGGRMPHVQGMVVGGATEIPTADKVAEYAARFKEVQKFVIELPLIYTLGSVYTDNVIAFGVFPED
2hthB1          EFYRRLSEEMTQRRW-------------------------------------------------------
1jj2H           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DAFAWGFTGVMVRGSGAAWDLRRSQPYECYSDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRL
2fug41          VAIDLGLTGGSLRASGVNYDVRKAYPYSGY-----DVPLGERGDVFDRMLVRIREMRESVKIIKQALERL
1cc1L           DDYKTFLPGVYIDGKDEEFDSKLVKEYVGHSFFDHSAPGGLHVGPLARMWVQNPELSPVGQKLLKELYGI
2hthB1          ----------------------------------------------------------------------
1jj2H           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SGKHRIGPVSSLDGKVVPPKRGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSN
2fug41          EP----GPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGS
1cc1L           EA----KKFRDLGDKAFSIMGRHVLRAVEKWLKQVQPGAETYVPDAAEGTGFTEAPRGALLHYLKIKD-K
2hthB1          ----------------------------------------------------------------------
1jj2H           ----KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPPVQIRHNALEAARVAANRYVQNSGAA


                         .         .         .         .         *         .         .:420
query           KPYRCKIRAPGYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR
2fug41          MPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR
1cc1L           KIENYQIVSATLWNANPRDDALIGVPVPDIKNPVNVGRLV------
2hthB1          ----------------------------------------------
1jj2H           ANYKFRIRKFPFHVIRENKDGMRAPGKPVGTAARVHGANHIFIAWV