[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87211.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1b5tA.bssp"
#ERROR : Can't open dsspfile "1v93A.bssp"

## Summary of PDB Search
:306
    2e-31  19%  1b5tA  [c.1.23.1] PROTEIN (METHYLENETETRAHYDROFOLATE REDUCTASE)
    2e-10  19%  1v93A  [c.1.23.1] 5,10-METHYLENETETRAHYDROFOLATE REDUCTASE
:306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxSIEVMPRTAAKIDDFRNILPDGTRVYIAHIDGTPIADMVSTAKR
1b5tA           --------------------------SFEFFPRTSEMEQTLWNSLSSLKPKFVSGANSGERDRTHSIIKG
1v93A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPAGSFSSSIDMIETGLFDKMGF
1b5tA           IKDRGLEAAPHLTCIDAT-PDELRTIARDYW-NNGIRHIVALRGDLPPGSGKEMYASDLVT--LLKEVAD
1v93A           -------------------RKEVAEVLHRFV-ESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALI


                         +         .         .         .         .         *         .:210
query           THLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIP
1b5tA           FDISVAAYPEVHPEAKSAQA-----DLLNLKRKVDAGANR---AITQFFFDVESYLRFRDRCVSAGIDVE
1v93A           RERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFA-ITQLFFNNAHYFGFLERARRAGIGIP


                         .         .         .         +         .         .         .:280
query           VHVGIAGPTKLQTLIKFAIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAANPDSLIEHVHI
1b5tA           IIPGILPVSNFKQAKKFADMTNVRIPAWMAQMDGLDDDAETRKLVGANIAMDMVKILSRE---GVKDFHF
1v93A           ILPGIMPVTSYRQLRRFTEVCGASIPLAKLERHQDDPKEIGV-----EHAVRQV---AELLEAGVEGVHF


                         .         *         .         .         .         .         +:350
query           FPLGGIKPSAEWMKxxxxxxxxxxxx
1b5tA           YTLNRAEMSYAICH------------
1v93A           YTLNKSPATRMVLE------------