[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87429.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1bkjA.bssp"
#ERROR : Can't open dsspfile "1vfrA.bssp"
#ERROR : Can't open dsspfile "1ywqA1.bssp"
#ERROR : Can't open dsspfile "1ds7A.bssp"
#ERROR : Can't open dsspfile "2ifaA1.bssp"
#ERROR : Can't open dsspfile "1zchA1.bssp"
#ERROR : Can't open dsspfile "1noxA.bssp"
#ERROR : Can't open dsspfile "1vkwA.bssp"
#ERROR : Can't open dsspfile "2freA1.bssp"
#ERROR : Can't open dsspfile "2b67A1.bssp"

## Summary of PDB Search
:228
    5e-32  25%  1bkjA  [d.90.1.1] NADPH-FLAVIN OXIDOREDUCTASE
    9e-31  12%  1vfrA  [d.90.1.1] NAD(P)H\:FMN OXIDOREDUCTASE
    4e-30  22%  1ywqA1 [d.90.1.1] NITROREDUCTASE FAMILY PROTEIN A:2 -- 200
    2e-27  14%  1ds7A  [d.90.1.1] FMN-DEPENDENT NITROREDUCTASE
    3e-27  16%  2ifaA1 [d.90.1.1] HYPOTHETICAL PROTEIN SMU.260 A:2 -- 200
    2e-26  17%  1zchA1 [d.90.1.1] HYPOTHETICAL OXIDOREDUCTASE YCND A:1 -- 249
    2e-25  27%  1noxA  [d.90.1.1] NADH OXIDASE
    7e-22  10%  1vkwA  [d.90.1.2] PUTATIVE NITROREDUCTASE
    3e-18  26%  2freA1 [d.90.1.1] NAD(P)H-FLAVIN OXIDOREDUCTASE A:1 -- 200
    3e-16  19%  2b67A1 [d.90.1.1] COG0778: NITROREDUCTASE A:1 -- 201
:228

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxAEREAIYRAIETRRDVRDQFLPDPLPEELVERLLKAAHSAPSVGFMQPWNFT
1bkjA           ----------------------NTIETILAHRSIR-KFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIV
1vfrA           ---------------------HPIIHDLENRYTSKKYDPSKKVSQEDLAVLLEALRLSASSINSQPWKFI
1ywqA1          ------------------ATTTNLKEAIVNRRSIRKVTKNDAITKERIEEVLKTALHAPTSFNMQSGRMV
1ds7A           -----------------------IISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFI
2ifaA1          ----------------------NFLDLQKQRRSIYALGKTVDLSKAELVALIQNAIQAPSAFNSQTSRAL
1zchA1          ----------------------EVIKSLTDHRSIR-SYTDEPVAQEQLDQIIEAVQSAPSSINGQQVTVI
1noxA           -----------------------AKTAALKRRSIR-RYRKDPVPEGLLREILEAALRAPSAWNLQPWRIV
1vkwA           -----------------------IFEAIENRHSVR-DFLERKXPERVKDDIENLLVKFITKKLDWKINLS
2freA1          -----------------------VDPLFLDRWSPR-AFDGSPXPKEHLLTILDAAHWAPSASNHQPWRFV
2b67A1          --------------------------LNKKRHATK-HFTDKLVDPKDVRTAIEIATLAPSAHNSQPWKFV


                         .         .         *         .         .         .         .:140
query           LVTDGGVRQAAWVAFSRANEEAAAMFEGEKQALYRSLKLEGIRKAPLSICVTCDPTRGGKVVLGRTHNPR
1bkjA           RVTDSEKRELAQFAGNQAYVESAAEF--------LVFCIDYQRHATINPDVQADF----------TELTL
1vfrA           VIESDAAKQRMHDSFANMHQFNQPYTRDDYDVVLSKAVADKRITEEQKEAAFASFKFVELNCDENGEHKA
1ywqA1          VLMD-----GEHEKFWDIVKETLRARVPAENFEATVERLKGFHAGVGTVLFFEDQATVEKMPLYKDQFPF
1ds7A           VASTEEGKAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFAD
2ifaA1          VLFGQDSQD----FWNKIAYSELEKVTPAEAFAGTKAKLESFAAGVGTILLFEDQAVEENFPLYAENFQP
1zchA1          TVQDKERKK-----------KISELAGGQPW----------IDQAPVFLLFCADFNRAKIALEDL----H
1noxA           VVRDPATK-----------RALREAAFGQAH----------VEEAPVVLVLYADLEDALAHEVIHPGVQG
1vkwA           SFPSYIYAKDELVEYGFQGEQIVLFLTAQGFGTCWXARSPHPDVPYIIVFGYPRTRNFTRKRRPITSFEN
2freA1          YAHK----------------------DSEDWPLFVELLXEGAKNASVLLFVISRDHT-------ISHEG-
2b67A1          VVREKNAELAAYGSNFEQVSSAPVTLFTDTDLAKRARKIARVNFSEEQLQYFXKNLPAEFARYSEQQVSD


                         +         .         .         .         .         *         .:210
query           TDVYSTVCAIQNLWLAARAEGIGVGWVSIFHDSDVRAILDIPEHIEIVAWLCLGRVDALYTEPELAVKGW
1bkjA           IGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNAQVDELLGLPENSAVLFGMCLGHPD--------QNPEV
1vfrA           WTKPQAYLALGNALHTLARLNIDSTTMEGIDPELLSEIFADELGYECHVALAIGYHHP---SEDYNASLP
1ywqA1          WSHQGNAMLQHTVWMLLSAEGIGASLQHPIVDAEVKETWNIPAEWSLVGQMPFGEPN--------EQPAE
1ds7A           MHRK---DLHDDAEWMAKQVYLNVGNIEGFDAAILDAEFGLKEGYTSLVVVPVGHHS----VEDFNATLP
2ifaA1          WSEQAHGIALYAIWLALAEQNIGXSVQHYLVDAQVAEKYDLPTNWKXRAQIPFGSIE--------APAGE
1zchA1          DFKMEITNGLESVLVGAVDAGIALGPIGAVNPQELIELLELPKYVFPLSGLVIGHPADRS--------AK
1noxA           ERREAQKQAIQRAFAAMGQEARKAWAMLGFDPERVRAILGLPSRAAIPALVALGYPAEEG--------YP
1vkwA           DLEELPPEIVKIVEXTILAPSALNRKIKYTGGELCISSERPVDLGIALSHAYLTAREIFKREPVI-----
2freA1          ----------EKKPSATHSFDAGAAWFSLAXQAHIVEKLDIPDGFKVEAGVAIGTLTDKSILPDAEREVP
2b67A1          YLALNAGLVAXNLVLALTDQGIGSNIILGFDKSKVNEVLEIEDRFRPELLITVGYTD---EKLEP-----


                         .         .         .         +         .         .         .:280
query           RQRVPLEELVFRNRWGGR
1bkjA           KPRLPAHVVVHENQYQ--
1vfrA           KSRKAFEDVI--------
1ywqA1          RTFLPTEDVV--------
1ds7A           KSRLPQNITLTE------
2ifaA1          KEFXADQERFKVF-----
1zchA1          KPRLPQEAVNHQETYLNQ
1noxA           SHRLPLERVVL-------
1vkwA           ------------------
2freA1          SKRVPLADVAFEGRFTGK
2b67A1          SYRLPVDEIIEK------