[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87597.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1jiiA.bssp"
#ERROR : Can't open dsspfile "1h3eA1.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1o5tA.bssp"
#ERROR : Can't open dsspfile "1h3eA2.bssp"
#ERROR : Can't open dsspfile "1jh3A.bssp"
#ERROR : Can't open dsspfile "1p9kA.bssp"
#ERROR : Can't open dsspfile "1fjgD.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"

## Summary of PDB Search
:417
    e-108  44%  1jiiA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    9e-76  26%  1h3eA1 [c.26.1.1] TYROSYL-TRNA SYNTHETASE A:6 -- 351
    1e-24  17%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    3e-21  13%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    2e-18  20%  1o5tA  [c.26.1.1] TRYPTOPHANYL-TRNA SYNTHETASE
    2e-08  32%  1h3eA2 [d.66.1.4] TYROSYL-TRNA SYNTHETASE A:352 -- 432
    4e-08  29%  1jh3A  [d.66.1.4] TYROSYL-TRNA SYNTHETASE
    5e-08  18%  1p9kA  [d.66.1.6] ORF, HYPOTHETICAL PROTEIN
    5e-06  17%  1fjgD  [d.66.1.2] 30S RIBOSOMAL PROTEIN S4
    2e-04  18%  1dm9A  [d.66.1.3] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
:417

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMMLHWMQKTGHQP
1jiiA           -----NVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRP
1h3eA1          -------------KRGAEEIVPEEELLAKLKEGRPLTVKLGADPTRPDLHLGHAVVLRKMRQFQELGHKV
1j1uA           -----------------TSEIISEEELREVLKKDEKSAYIGFEPSGK-IHLGHYLQIKKMIDLQNAGFDI
1d2rA           ------------------------------------TIFSGIQPSGV-ITIGNYIGALRQFVELQHEYNC
1o5tA           -------------RRGIFFSHRDNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVP
1h3eA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAENPALMINNADWLRGLNYLEF
1jiiA           IVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGT-DHGAVLVNNRDWLGQISLISF
1h3eA1          VLIIGDFTGMIGDPSGRSKTRPPLTLEETRENAKTYVAQAGKILRQE--PHLFELRYNSEWLEGLTFKEV
1j1uA           IILLADLHAYLNQKGELDEIRKIG--DYNKKVFEAMG------LKAK-------YVYGSEFQLDKDYTLN
1d2rA           YFCIVDQHAITVWQDPHELRQ---NIRRLAALYLAVGIDPTQATLFIQSEVPAH-------------AQA
1o5tA           LVIQ-----MTDDEKYLWKDLT------LDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMMSSGFYKN
1h3eA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQAYDFVELNQRTGCRLQMGGSDQWGNIINGI
1jiiA           LRDYGKHVGVNYMLGKDSIQSRL--EHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGI
1h3eA1          VR-LTSLMTVAQMLEREDFKKRYEAGIPISLHELLYPFAQAYDSVAIR----ADVEMGGTDQRFNLLVGR
1j1uA           VYRLALKTTLKRARRSMELIAREDENP--KVAEVIYPIMQVNDIHYL----GVDVAVGGMEQRKIHMLAR
1d2rA           AWMLQCIVYIGELERMTQFKEKSAGAAAAAAGLLTYPPLMAADILLY----NTDIVPVGEDQKQHIELTR
1o5tA           VVKIQKHVTFNQ------VKGIFGFTDSDCIGKISFPAIQAAPSFSFRDRTDQCLIPCAIDQDPYFRMTR
1h3eA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLGHRMGTPQLYALTSPLLTTXXXXXXXXXXXXXVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLP
1jiiA           ELMRRMGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLG
1h3eA1          EVQRAYGQSPQVCFLMPLLVLDGREKMSKSLDNYIGLTE---PPEAMFKKLMRVPDPLLPSYFRLLTDLE
1j1uA           ELLPKKVVGLDGEGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLT
1d2rA           DLAERFNKRYGELFTIPEARVDPTKKMSKSDPNPKAYITLLDDAKTIEKKIKSEAKPGISNLLNIYSTLS
1o5tA           DVAPRIGYPKPALLHSTFF---------------------------------------------------
1h3eA2          ----------------------------------------------------------------------
1jh3A           ----------------------------------------------------------------------
1p9kA           ----------------------------------------------------------------------
1fjgD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MDEIARIATLGGSEINEAKKILATEVTAILHGxxxxxxxxxxxxxxxxxGALAENLPSIEVPTSELDAGV
1jiiA           KEEIDRLSKNEAPHLREAQKTLAEEVTKFIHG--------------------------------------
1h3eA1          EEE---IEALLKAGPVPAHRVLARLLTAAYA---------------------------------------
1j1uA           VNSYEELESNKELHPMDLKNAVAEELIKILEP--------------------------------------
1d2rA           GQSIEELRQYEGKGYGVFKADLAQVVIETLRP--------------------------------------
1o5tA           ----------------------------------------------------------------------
1h3eA2          -----------------------------------------------------EEIPEVTIPASELKGRI
1jh3A           -----------------------------------------------------------DVPSFVHEGDV
1p9kA           -------------------------------------------------GSMIHRMSNMATFSLGKHPHV
1fjgD           -------------------------------------------------ASKKKGVTGSVF---LGLLES
1dm9A           ------------------------------------------------------------------AVEV


                         .         .         .         .         *         .         .:420
query           GVLSLIVRAGLASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA
1jiiA           -------------------------------------------------------------------
1h3eA1          -------------------------------------------------------------------
1j1uA           -------------------------------------------------------------------
1d2rA           -------------------------------------------------------------------
1o5tA           -------------------------------------------------------------------
1h3eA2          WVARLFTLAGLTPSNAEARRLIQNRGLRLDGEVLTDPMLQVDLSR-----PRILQRGKDRFVRVRLS
1jh3A           PLVELLVSAGISPSKRQAREDIQNGAIYVNGERLQDVGAILTAEHRLEGRFTVIRRGKKKYYLIRYA
1p9kA           ELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAVETRKRCKIVAGQT-------VSFAGHSVQVV---
1fjgD           RLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGD-----EIAVAEKSRNLELI---
1dm9A           RLDKWLWAARFYKTRALAREMIEGGKVHYNGQRSKPSKIV-----ELNA-TLTLRQGNDERTVIVKA