[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87761.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gh6A.bssp"
#ERROR : Can't open dsspfile "2nraC1.bssp"
#ERROR : Can't open dsspfile "1fpoA1.bssp"
#ERROR : Can't open dsspfile "1repC1.bssp"
#ERROR : Can't open dsspfile "2doeA1.bssp"
#ERROR : Can't open dsspfile "1bq0A.bssp"
#ERROR : Can't open dsspfile "1fafA.bssp"
#ERROR : Can't open dsspfile "1iurA.bssp"
#ERROR : Can't open dsspfile "1uzcA.bssp"
#ERROR : Can't open dsspfile "1wjzA.bssp"
#ERROR : Can't open dsspfile "1nz6A.bssp"
#ERROR : Can't open dsspfile "1ny9A.bssp"
#ERROR : Can't open dsspfile "2dodA1.bssp"
#ERROR : Can't open dsspfile "1n4cA.bssp"

## Summary of PDB Search
:200
    5e-14  36%  1gh6A  [a.2.3.1] LARGE T ANTIGEN
    2e-12  12%  2nraC1 [a.4.5.10] PI PROTEIN C:9 -- 151
    9e-12  25%  1fpoA1 [a.2.3.1] CHAPERONE PROTEIN HSCB A:1 -- 76
    9e-12  12%  1repC1 [a.4.5.10] PROTEIN (REPLICATION INITIATION PROTEIN) C:15 --
    2e-11  13%  2doeA1 [a.159.2.1] TRANSCRIPTION ELONGATION REGULATOR 1 A:784 --
    8e-11  35%  1bq0A  [a.2.3.1] DNAJ
    1e-10  24%  1fafA  [a.2.3.1] LARGE T ANTIGEN
    2e-10  19%  1iurA  [a.2.3.1] KIAA0730 PROTEIN
    5e-10  11%  1uzcA  [a.159.2.1] HYPOTHETICAL PROTEIN FLJ21157
    8e-10  26%  1wjzA  [a.2.3.1] 1700030A21RIK PROTEIN
    4e-09  19%  1nz6A  [a.2.3.1] AUXILIN
    4e-09  14%  1ny9A  [a.181.1.1] TRANSCRIPTIONAL ACTIVATOR TIPA-S
    6e-09  15%  2dodA1 [a.159.2.1] TRANSCRIPTION ELONGATION REGULATOR 1 A:651 --
    7e-09  18%  1n4cA  [a.2.3.1] AUXILIN
:200

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVFDDTGYDPxxx
1gh6A           --QLMDLLGLERSANIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGF----
2nraC1          --DLAALAKITPSLAYRQLKEGGKLLGASKISLRDDIIALAKELNSEELDLNIIEWIAYSPDEGYL----
1fpoA1          -MDYFTLFGLPAQLDTQALSLRFQDLQRQYHPDKFASGQQSATINQAWQTLRHPLMRAEYL---------
1repC1          --KYAEIFGLTSAEASKDIRQALKSFAGKEVSFPWFIKPAHSPSRGLYSVHINPYLIPFFIG--------
2doeA1          ---------EDSKTRGEKIKSDFFELLSNHHLDSSKVKDKVESDPRYKAVDSSSMREDLFKQYI------
1bq0A           --DYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEFKEIKEAYEVLTDSQKRAAYDQYGHAA---
1fafA           -------------GDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGG------
1iurA           LKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPENEVFKHLQNEINRLEKQAFLDQNADRA------
1uzcA           ---------TYTWNTKEEAKQAFKELLKEKRVPSWEQAMKMIINDPRYSALAKLSEKKQAFN--------
1wjzA           --DWYSILGADPSANMSDLKQKYQKLILLYHPDQSADVPKFIEIDQAWKILGNEETKKKYDLQRSGP---
1nz6A           --TKWKPVGXADLVTPEQVKKVYRKAVLVVHPDKATGQPIFXELNDAWSEFENQGQKPLY----------
1ny9A           FVALMDAGEPADSEGAMDAAEDHRQGIARNHYD--CGYEMHTCLGEMYV--SDERFTRNIDAAKPGL---
2dodA1          ---------ERAIVPLEARMKQFKDMLLERGVSAFEKELHKIVFDPRYLLLNPKERKQVFDQYV------
1n4cA           GETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGKMIFMELNDAWSEFENQGQKPLY----------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gh6A           ----------------------------------------------------------------------
2nraC1          ----------------------------------------------------------------------
1fpoA1          ----------------------------------------------------------------------
1repC1          ----------------------------------------------------------------------
2doeA1          ----------------------------------------------------------------------
1bq0A           ----------------------------------------------------------------------
1fafA           ----------------------------------------------------------------------
1iurA           ----------------------------------------------------------------------
1uzcA           ----------------------------------------------------------------------
1wjzA           ----------------------------------------------------------------------
1nz6A           ----------------------------------------------------------------------
1ny9A           ----------------------------------------------------------------------
2dodA1          ----------------------------------------------------------------------
1n4cA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gh6A           ------------------------------------------------------------
2nraC1          ------------------------------------------------------------
1fpoA1          ------------------------------------------------------------
1repC1          ------------------------------------------------------------
2doeA1          ------------------------------------------------------------
1bq0A           ------------------------------------------------------------
1fafA           ------------------------------------------------------------
1iurA           ------------------------------------------------------------
1uzcA           ------------------------------------------------------------
1wjzA           ------------------------------------------------------------
1nz6A           ------------------------------------------------------------
1ny9A           ------------------------------------------------------------
2dodA1          ------------------------------------------------------------
1n4cA           ------------------------------------------------------------