[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87844.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f0kA.bssp"
#ERROR : Can't open dsspfile "2iv7A1.bssp"
#ERROR : Can't open dsspfile "2hagA1.bssp"
#ERROR : Can't open dsspfile "1iirA.bssp"
#ERROR : Can't open dsspfile "2acvA1.bssp"
#ERROR : Can't open dsspfile "1abeA.bssp"
#ERROR : Can't open dsspfile "1gz5A.bssp"

## Summary of PDB Search
:378
    4e-53  33%  1f0kA  [c.87.1.2] UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-
    3e-09  15%  2iv7A1 [c.87.1.8] LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN A:2
    3e-06  13%  2hagA1 [d.58.4.14] MELANIN BIOSYNTHESIS PROTEIN TYRA, PUTATIVE A:5
    6e-05  29%  1iirA  [c.87.1.5] GLYCOSYLTRANSFERASE GTFB
    1e-04  13%  2acvA1 [c.87.1.10] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1
    2e-04  20%  1abeA  [c.93.1.1] L-ARABINOSE-BINDING PROTEIN
    6e-04  13%  1gz5A  [c.87.1.6] ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSATIGSKNPISV
1f0kA           -----LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGADRMEADLVPKHGIEIDFIRISGLRGKGIKAL
2iv7A1          -------------GGLQRDFXRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKS-----HTNHGRN
2hagA1          ----------------------------------------------------------------------
1iirA           -----VLLATCGSRGDTEPLVALAVRVRDLGADVRMCAPPDCAERL------------------------
2acvA1          -----LIFIPAPGIGHLASALEFAKLLTNHDKNLYITVFCIKFPGMPFADSYIKSVLAS-----------
1abeA           ----------------------------------------------------------------------
1gz5A           ------LKAAGGLGETGNEDQPLKKVKKGNITWASFNL-SEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQ


                         .         .         *         .         .         .         .:140
query           VRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSIIHEQNAVMGRANKALAARVKA
1f0kA           IAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATK
2iv7A1          AEYYAWVQ-------NHLKEHPADRVVGFNKXPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYRHYAAFE
2hagA1          ----------------------------------------------------------------------
1iirA           ----------------------------------------------------------------------
2acvA1          ----------------------------------------------------------------------
1abeA           ----------VRATEGQGFKAADIIGIGINGVDAVSELSKAQATGFYGSLLPSPDVHGY--KSSEMLYNW
1gz5A           RPAWDGY---LRVNALLADKLLPIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDT


                         +         .         .         .         .         *         .:210
query           IAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQTGETFQLVVFGGSQGAQFFSSAVPAAICLM
1f0kA           VMQAFPGAF-----PNAEVVGNPVRTDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKL
2iv7A1          RATFEQGKSTQTEPERFQILPPGIYPDRKYSEQIPNSREIKEQQNLLLQVGSDFGRKGVDRSIEALASLP
2hagA1          ------------------------------------------------------------PREQLGVCA-
1iirA           ----------------------------------------------------------------------
2acvA1          ----------------------------------------------------------------------
1abeA           VAKDVEPP--------------------------------------------------------------
1gz5A           LLEQLC----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KDEQRKRIVVTQQARPEDKDSVIASYQKLGVKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRP
1f0kA           GD----SVTIWHQSGKGSQQSVEQAYAEAGPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLP
2iv7A1          ESLRHNTLLFVVGQDKPRKFEALAEKLGVRSNVHFFSGRNDVSELXAAADLLLQEAAGIVLLEAITAGLP
2hagA1          -EGNLHSVYLXFNANDNVESQLRPCIANV------AQYIYELTDQYSDSAFNGFVAGANYWDSLYPESRP
1iirA           ----------------------------------------------------------------------
2acvA1          ----------------------------------------------------------------------
1abeA           ----------------------------------------------------------------------
1gz5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SILVPYPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f0kA           ALFVPFQ---------------------------------------------------------------
2iv7A1          VLTTAVC---------------------------------------------------------------
2hagA1          EXLKPFP---------------------------------------------------------------
1iirA           ----------------------------------------------------------------------
2acvA1          ----------------------------------------------------------------------
1abeA           ----------------------------------------------------------------------
1gz5A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f0kA           ----------------------------
2iv7A1          ----------------------------
2hagA1          ----------------------------
1iirA           ----------------------------
2acvA1          ----------------------------
1abeA           ----------------------------
1gz5A           ----------------------------