[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87903.2

[Show Plain Result]

#ERROR : Can't open dsspfile "2afaA1.bssp"
#ERROR : Can't open dsspfile "1fp3A.bssp"
#ERROR : Can't open dsspfile "1nc5A.bssp"
#ERROR : Can't open dsspfile "1vd5A.bssp"
#ERROR : Can't open dsspfile "1dl2A.bssp"

## Summary of PDB Search
:415
    2e-62  38%  2afaA1 [a.102.1.3] NAG ISOMERASE A:4 -- 415
    7e-13  16%  1fp3A  [a.102.1.3] N-ACYL-D-GLUCOSAMINE 2-EPIMERASE
    4e-11   9%  1nc5A  [a.102.1.6] HYPOTHETICAL PROTEIN YTER
    2e-07  19%  1vd5A  [a.102.1.7] UNSATURATED GLUCURONYL HYDROLASE
    4e-05   8%  1dl2A  [a.102.2.1] CLASS I ALPHA-1,2-MANNOSIDASE
:415

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxTLPWHRQWLVKQVEGLFDFFQHRALNPAGGFFDLDAKGAPLQANDPVRGIHASARMVH
2afaA1          ----------------HNRWLEQETDRIFNFGKNAVV--PTGFGWLGNKGQIK--EEXGTHLWITARXLH
1fp3A           ------------TLQAWKERVGQELDRVMAFWLEHSHDREHGGFFTCLGRDG-RVYDDLKYVWLQGRQVW
1nc5A           ----------------------------------------------------------------------
1vd5A           ----------------------------------------------------------------------
1dl2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CFSIGHLLGRPGCGDIVDHGMTYLWNNHRDGEHGGYFWQVNDAGPVDATKQGYGHAFVLLAASSAKTVGH
2afaA1          VYSVAASXGRPGAYDLVDHGIKAXNGALRDKKYGGWYACVNDQGVVDASKQGYQHFFALLGAASAVTTGH
1fp3A           MYCRLYRKLERFHRDAAKAGGEFLLRHARVAPPEKKCALTRDGRPVKVQRSIFSECFYTMAMNLWRVTAE
1nc5A           ----------------------------------------------------------------------
1vd5A           -----------------------------------------------------GFLYSLSAKAQWIVEKD
1dl2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PLADQMLADITEVLETRFWEEKHGAIAEEFNRDWSPIDNYRGQNSNMHLTEALMAAYEATGDSNYLTKAE
2afaA1          PEARKLLDYTIEVIEKYFWSEEEQXCLESWDEAFSQTEDYRGGNANXHAVEAFLIVYDVTHDKKWLDRAL
1fp3A           ARYQSEAVDMMDQIVHWVREDPSGLGR------PQLPGAVASESMAVPMMLLCLVEQLGEEDEELAGRYA
1nc5A           ---------------------------------KDGYPYQMWLDGLYMGGPFALKYANLKQETELFDQVV
1vd5A           ESARKLALDAADVLMRRWRA--DAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAE
1dl2A           ---------------------------------------HTSHNMPRGNQPLGWIIVDSVDTLMLMYNSS


                         .         .         .         +         .         .         .:280
query           RIADLVIRRRAGELDFRVPEHFDENWTLDKAYRGNEMFRPSGSTPGHWLEWARLILQLWVLGERQHDWMP
2afaA1          RIASVIIHDVARNGDYRVNEHFDSQWNPIRDYNKDHRFRAYGGTPGHWIEWGRLXLHLEARFETPPAWLL
1fp3A           QLGHWCARRILQHVQRDGQAVLENVSEDGEELSGCLGRHQ---NPGHALEAGWFLLRHSSRSGDAKLRAH
1nc5A           LQESLMRKHTKDAKTGLFYHAWDEAKKMPWANEETGCSPEFWARSIGWYVMSLADMIEELPKKHPNRHVW
1vd5A           AHALKSRR-----------FLVRGDDSSYHTFNGNAIRGGTHQGNTDGSTWTR--GQAWGIYALNSRYLG
1dl2A           TLYKSEFEAEIQRSEHWINDVLDDIDAEVNVFETTIRMLGGLLSAYHLSDVLEVGNKTVYLNK-------


                         .         *         .         .         .         .         +:350
query           VAAKSLFVQSMALGWDREKGGFFYTLDWNDNPDKRAKLWWPMCEAAGAAHFLNENLPADAFYEDSYRRIW
2afaA1          EDAKGLFHATIRDAWAPDADGFVYSVDWDGKPIVRERVRWPIVEAXGTAYALYT-LTDDSQYEEWYQKWW
1fp3A           VIDT-FLLLPFRSGWDADHGGLFYFQDADGLCPTQMKLWWPHSEAMIAFLMGY-SESGDPALLRLFYQVA
1nc5A           KNTLQDMIKSICRYQDKETGLWYQIVDKGDRSDNWLESSGSCLYMYAIAKGINK-GYLDRAYETTLLKAY
1vd5A           NADLLETAKRMARHFVPEDGVVYWDFEVPQEPSSYRDSSASAITACGIASQLDESDPERQRFIDAAKTTV
1dl2A           --AIDLGDRLALAFLSTQTGIPYSSINLHS------GQAVKNHADGGASSTAEFTTLQMEFKYLAYLTGN


                         .         .         .         .         *         .         .:420
query           STIANNFIDHENGGWHEELTEDLVPAHTLFPGKGDIYHALQACLIPLFPAAGSLTTVIxxxxxxx
2afaA1          DYCIKYLXDYENGSWWQELDAD----NKVTTGKQDIYHLLHCLVIPRLPLAPGLAPAV-------
1fp3A           EYTFRQFRDPEYGEWFGYLNRE-------------------------------------------
1nc5A           QGLIQHKTETSEDGA--------------------------------------------------
1vd5A           TALRDGYAERDDGE---------------------------------------------------
1dl2A           RT---------------------------------------------------------------