[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87951.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pxfA.bssp"
#ERROR : Can't open dsspfile "1e7zA.bssp"
#ERROR : Can't open dsspfile "1b70B3.bssp"

## Summary of PDB Search
:113
    6e-22  29%  1pxfA  [b.40.4.4] HYPOTHETICAL PROTEIN YGJH
    7e-20  18%  1e7zA  [b.40.4.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    2e-16  21%  1b70B3 [b.40.4.4] PHENYLALANYL-TRNA SYNTHETASE B:39 -- 151
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPESLVGRQVLGV
1pxfA           ---TVAYADFARLEMRVGKIVEVKRHENADKL-YIVQVDVGQ--KTLQTVTSLVPYYSEEELMGKTVVVL
1e7zA           ------PIDVSRLDLRIGCIITARKHPDADSL-YVEEVDVGEI-APRTVVSGLVNHVPLEQMQNRMVILL
1b70B3          ------FPIPRGV--VFARVLEAHPIPGTRL--KRLVLDAGRTVEVVSGAENARKGGVALALPGTELPGL


                         .         .         *         .         .         .         .:140
query           VNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMx
1pxfA           CNLQKAKMRGETSECMLLCAETDDGESVLLTPERMMPAGVRV-
1e7zA           CNLKPAKMRGVLSQAMVMCASSPEKI-EILAPPNGSVPGDRI-
1b70B3          GKVGERVIQGVRSFGMALSPRELGGGGLLEFPEDALPPGTP--