[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK87977.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1q6wA.bssp"
#ERROR : Can't open dsspfile "1s9cA2.bssp"
#ERROR : Can't open dsspfile "2bi0A1.bssp"
#ERROR : Can't open dsspfile "2c2iA1.bssp"
#ERROR : Can't open dsspfile "1iq6A.bssp"
#ERROR : Can't open dsspfile "1pn2A2.bssp"
#ERROR : Can't open dsspfile "2bi0A2.bssp"
#ERROR : Can't open dsspfile "2f3xA1.bssp"
#ERROR : Can't open dsspfile "1z6bA1.bssp"
#ERROR : Can't open dsspfile "1sh8A.bssp"
#ERROR : Can't open dsspfile "2b3mA1.bssp"
#ERROR : Can't open dsspfile "2aliA1.bssp"
#ERROR : Can't open dsspfile "2ov9A1.bssp"
#ERROR : Can't open dsspfile "2gvhA2.bssp"
#ERROR : Can't open dsspfile "1c8uA1.bssp"

## Summary of PDB Search
:155
    5e-27  29%  1q6wA  [d.38.1.4] MONOAMINE OXIDASE REGULATORY PROTEIN, PUTATIVE
    9e-17  11%  1s9cA2 [d.38.1.4] PEROXISOMAL MULTIFUNCTIONAL ENZYME TYPE 2 A:10 --
    2e-15  13%  2bi0A1 [d.38.1.4] HYPOTHETICAL PROTEIN RV0216 A:8 -- 185
    1e-13  22%  2c2iA1 [d.38.1.4] RV0130 A:2 -- 150
    4e-13  24%  1iq6A  [d.38.1.4] (R)-SPECIFIC ENOYL-COA HYDRATASE
    7e-11  18%  1pn2A2 [d.38.1.4] PEROXISOMAL HYDRATASE-DEHYDROGENASE-EPIMERASE
    4e-09  16%  2bi0A2 [d.38.1.4] HYPOTHETICAL PROTEIN RV0216 A:186 -- 337
    5e-08  15%  2f3xA1 [d.38.1.5] TRANSCRIPTION FACTOR FAPR A:66 -- 186
    5e-08  17%  1z6bA1 [d.38.1.6] FATTY ACID SYNTHESIS PROTEIN A:84 -- 229
    6e-07  15%  1sh8A  [d.38.1.5] HYPOTHETICAL PROTEIN PA5026
    1e-06  19%  2b3mA1 [d.38.1.4] HYPOTHETICAL PROTEIN AF1124 A:6 -- 159
    5e-06  13%  2aliA1 [d.38.1.1] HYPOTHETICAL PROTEIN PA2801 A:5 -- 134
    1e-05   8%  2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209
    2e-05  13%  2gvhA2 [d.38.1.1] AGR_L_2016P A:147 -- 262
    1e-04  11%  1c8uA1 [d.38.1.3] ACYL-COA THIOESTERASE II A:2 -- 115
:155

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLAELSPIGERVTLDTLHFSAEDIIRFARDFDPQPFHLDAEAARNSVFGGLCASGWHTGAGWMKSFLSH
1q6wA           -------QIGEKIEGLPRTVTETDIWTFAYLADFFPLHTDVEFAKKTIFGKPIAQGXLV--------LSI
1s9cA2          --------IGQKLPPFSYAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQ------
2bi0A1          -------SKGQVFDAPGVTLSLGLAAAHQSVGNRLRLALDSDLCAAVTGPGPLAHPGLVCDVAIGQSTLA
2c2iA1          --------------SDWVTITQEEVNLFADTGDHQWIHVDPERAAAGPFGTTIAHGFXTLALLPRLQHQX
1iq6A           ---AQSLEVGQKAR-LSKRFGAAEVAAFAALEDFNPLHLDPAFAATTAFERPIVHGMLLASLFSGLLGQQ
1pn2A2          -------LAPKRADYQVDVPVSEDLAALYRSGDRNPLHIDPNFAKGAKFPKPILHGXCTYGLSAKAL---
2bi0A2          --------IAGAVLH-STADLVSGAPELARTLNIAATHHDWRVSGRRL-----VYGGHTIGLALAQATRL
2f3xA1          -------------------SLDEVIGEIIDELDDQAISILEIKQEHVFSRNQIARGHHL-FAQANSLAVA
1z6bA1          -----------------IYMQPNKTIIGLKQVSTNEPFFNGHFPQKQIMPGVLQIEALAQLAGI------
1sh8A           -LTEEKIAFVQRSGLRAEVLEPGYVRLRM----PGAGNENH---IGSMYAGALFTLAELPGGALF-----
2b3mA1          ----GELKEGYRFEYEKKLCEIDVAMFGLISGDLNPVHFDEDFASKTRFGGRVVHGMLT-----TSLVSA
2aliA1          --------------------------LHTAHIPVRWGDXDSY---GHVNNTLYFQYLEEARVAWFETLGI
2ov9A1          AGHLEEHAPAVAERL-IDXWNGEGVTRHDPVGPENALAPPVVLEGLSRGTVTLTIPYQGPPGHV--HGGV
2gvhA2          ---------------------------VTXVEIVFPDQANS---AGRXFGGEAIAYXTKAAFVAASRYC-
1c8uA1          -----------------------------------KIEEGLFRGQSEDLGLRQVFGGQV-VGQALYAAKE


                         .         .         *         .         .         .         .:140
query           WAKEVKRLKLQGLEPPKLGPSPGFRELKWKKPVFAGDDVTYFVTLLDARPLESRPGIWLNITFNEGVNQS
1q6wA           ALGXVDQVILSNYDVSSVIAFFGIKDVRFLRPVFIGDTIAASAEVVEKQDFDEKSGV---VTYLEVKNQR
1s9cA2          ---------------KSMMVLHGEQYLELYKPLPRAGKLKCEAVVADVLV---------VIIMDVYSYSE
2bi0A1          TQRVKANLFYR--------------GLRFHRFPAVGDTLYTRTEVVGLRANSPKPGRAPTGLAXTTIDRT
2c2iA1          Y----------TVKGVKLAINYGLNKVRFPAPVPVGSRVRATSSLVGVEDLGNGTVQATVSTTVEVEGSA
1iq6A           LPGKGSIY--------------LGQSLSFKLPVFVGDEVTAEVEVTALRE---DKPI---ATLTRIFTQG
1pn2A2          ---------------IDKFGXFNEIKARFTGIVFPGETLRVLAWKESDD----------TIVFQTHVVDR
2bi0A2          LPNLATVLDWE--------------SCDHTAPVHEGDTLYSELHIESAQAHADGGVLGLRSLYAVSASEP
2f3xA1          VI-------------DDELALTASADIRFTRQVKQGERV---VAKAKVTAVEKEKGRTVVEVNSYV---G
1z6bA1          ---------LCLKSDNNLFLFAGVDGVRWKKPVLPGDTLTMQANLISFKS---SLGIA---KLSGVGYVN
1sh8A           ---------LTSFDSARFYPIVKEMTLRFRRPAKGDIRVEARLDAERIRQLETEAGKAEYSLELQLTDEQ
2b3mA1          AVARLPG-----------TVVLLEQSFRYTSPVRIGD-----VVRVEGVVSGVEKNR---YTIVKCYTG-
2aliA1          D-----------LEGAAEGPVVLQSLHTYLKPVVHPATVVVELYAGRLG----TSSLVLEHRL-HTLEDP
2ov9A1          SALLLDHVLGVANAWGGKAGXTAQLSTRYHRPTPLFEPLTL-----TGKLXSVDGRKI--TTAGDIRTAD
2gvhA2          ---------------GKLVVLASSERIDFARAIEIGEIVEAQAHVERVGR--SSXSIQTKLWSENLLTGE
1c8uA1          TVPEER--------------LVHSFHSYFLRPGDSKKPIIY-----DVETLRDGNSF---SARRVAAIQN


                         +         .         .         .         .         *         .:210
query           GETVLTFQSGVLEFD
1q6wA           GELVLTA--------
1s9cA2          KELICHNQFSLF---
2bi0A1          DRLVLDF--------
2c2iA1          KPACVAE--------
1iq6A           GALAVTG--------
1pn2A2          GTIAINNAAIKL---
2bi0A2          DRQVLDWRFSALQF-
2f3xA1          EEIVFSGR-------
1z6bA1          GKVVINI--------
1sh8A           GEVVAES--------
2b3mA1          DKVVAEGVVKVL---
2aliA1          QGTYGEGHCKLVWVR
2ov9A1          GQVCVSVE-------
2gvhA2          RHITATG--------
1c8uA1          GKPIFYMT-------