[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK88218.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1vybA.bssp"
#ERROR : Can't open dsspfile "1zwxA1.bssp"
#ERROR : Can't open dsspfile "1wduA.bssp"
#ERROR : Can't open dsspfile "1akoA.bssp"
#ERROR : Can't open dsspfile "1ntfA.bssp"

## Summary of PDB Search
:281
    2e-11  16%  1vybA  [d.151.1.1] ORF2 CONTAINS A REVERSE TRANSCRIPTASE DOMAIN
    2e-11  19%  1zwxA1 [d.151.1.3] SPHINGOMYELINASE-C A:41 -- 333
    5e-11  12%  1wduA  [d.151.1.1] TRAS1 ORF2P
    4e-10  20%  1akoA  [d.151.1.1] EXONUCLEASE III
    4e-08  13%  1ntfA  [d.151.1.2] SALIVARY NITROPHORIN
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIASYNVHKCVGRDRKFDPDRTS
1vybA           ------------------------------------------------ILTLNINGLNSAIKR---HRLA
1zwxA1          ------------------------------------------------ITSHNVYLFPNWGQMHRADLIA
1wduA           ----------------------------------------------------------------------
1akoA           ------------------------------------------------FVSFNINGLRAR-----PHQLE
1ntfA           ------------------------------------------------TVSWNSGH------ERAPTNLE


                         .         .         *         .         .         .         .:140
query           RVIQEIGADIIALQEADSRFGERTGLLDLARLERESGLVPVPVQAGVKAHGWHGNVVLFREGAVRDVHTL
1vybA           SWIKSQDPSVCCIQETHLTCR------DTHRLKIKGWRKIYQANGK---QKKAGVAILVSDKTD---FKP
1zwxA1          QADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGRSKHGWDKTEEDGGVAVVSQWPIVEKSQH
1wduA           -------------------------------------------------DGTVKAAIAVFDHDL---DVI
1akoA           AIVEKHQPDVIGLQETKVHD---------DMFPLEEVAKLGYNVFYHGQKGHYGVALLTKETPIAVRRGF
1ntfA           ELLETPDVIAVAVQGFGFQTDKPQQGPACVKNFQSLLTSKGYTKLKNTITETMGLTVYCLEKLDQNTLKN


                         +         .         .         .         .         *         .:210
query           KLPGLEPRGALVVELDLKSGGTLRVIAAHFGLLRHSRAQQAKALVGLLEARNECATILMGDLNEWRLGNG
1vybA           TKIKRDKEGHYIMVKGSIQQEELTILNIYAPNTGAPRFIKQVLSD--LQRDLDSHTLIMGDFNTPLSTLD
1zwxA1          IFQRLSNKGFAYVKIMKN-GKPYHIIGTHTRAIRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVLKLLNV
1wduA           QYPQLTTNNIVVVGIRT-RAWEITLVSYYFEPDKPIESYLEQIKRVERKMGPKRL-IFGGDANAKARGDQ
1akoA           PGDDEEAQRRIIMAEIPSLLGNVTVINGYFPIKFPAKAQFYQNLYLETELKRDNPVLIMGDMNEREWMDR
1ntfA           ETIIQKKSGGIVTSFTI-YNKRFSFTTSRMSDSTNTKYAYDTRLDYSKKDDPSDFLFWIGDLNVRKAKEQ


                         .         .         .         +         .         .         .:280
query           SSLNTFRDAFGTLPPAVPSFPSNLPVLALDRIIANREGLIEQVEAHDSALARIASDHLPLKAAIRTDLxx
1vybA           RSTRQLIDIYRTLHPKSTEYTFFSAPHHIDHIVGSKALLSKCKRTE--IITNYLSDHSAIKLELR-----
1zwxA1          SSPANFNGQMATWDPTTNSMLKESYPEYLDYIFVENGHAWSVKSWFKTYTYQDFSDHYPVVG--------
1wduA           LMGTLGELGLHILNEGDVPTFDTRYQSRVDVTFCTED-MLDLIDGWRVDEDLVSSDHNGMVFNIRLQ---
1akoA           LMSWGLVDTFRHANPQTAKGFDDNRGLRIDLLLASQPLAECCVETYEIRSMEKPSDHAPVWATFR-----
1ntfA           KLFDGWTEPQVTFKPTYKFKPLSATPSWTDRALYKSGGKTIQPLSYNSLTNYKQTEHRPVLAKFRVTL--


                         .         *         .         .         .         .         +:350
query           x
1vybA           -
1zwxA1          -
1wduA           -
1akoA           -
1ntfA           -