[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK88284.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ng3A1.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "1pj5A2.bssp"
#ERROR : Can't open dsspfile "1an9A2.bssp"
#ERROR : Can't open dsspfile "1d4cA2.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1an9A1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"

## Summary of PDB Search
:427
    1e-25  17%  1ng3A1 [c.3.1.2] GLYCINE OXIDASE A:1 -- 218 A:307 -- 364
    3e-13  18%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    3e-06  13%  1pj5A2 [c.3.1.2] N,N-DIMETHYLGLYCINE OXIDASE A:4 -- 219 A:339 --
    5e-06  11%  1an9A2 [d.16.1.3] D-AMINO ACID OXIDASE A:195 -- 287
    5e-06  14%  1d4cA2 [c.3.1.4] FLAVOCYTOCHROME C FUMARATE REDUCTASE A:103 -- 359
    8e-06  24%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    8e-05   9%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    1e-04  16%  1an9A1 [c.4.1.2] D-AMINO ACID OXIDASE A:1 -- 194 A:288 -- 340
    0.001  19%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTGQSAALHLAEGGLDVILLEAKEIGFGGAGR
1ng3A1          ----------------------------------------GSAIAYYLAKENKNTALFESGTMGGRTTSA
1el5A1          ----------------------------------------GMAAGYQLAKQGVKTLLVDAFDPPHTNGSH
1pj5A2          --------------------------------------IVGTNLADELVTRGWNNITVLDQGPLNMPGGS
1an9A2          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------GLAAAVSARDAGAKVILLEKEPIPGGNTKL
2gqfA1          ----------------------------------------GLFCAAQLAKLGKSVTVFDNGK----KIGR
1d7yA1          --------------------------------------LASVSFVAELRQAGYQGLITVVGDEAERPYDR
1an9A1          ---------------------------------------IGLSTALCIHERYHSVLQPLDVKVYADRFTF
2ivdA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPCEIEKNGTLHCAVGEKGLAEI
1ng3A1          AAGMLGAHAECEERDAFFDFAMHSQRLYKGLG-------EELYALSGVDIRQHNGGMFKLAFSEEDVLQL
1el5A1          HGDTRIIRHAYGEGREYVPLALRSQELW-----------YELEKETHHKIFTKTGVLVFGPKGES--AFV
1pj5A2          TSHAPGLVFQTNPSKTMASFAKYTVEKLLSLTEDG----------VSCFNQVGGLEVATTETRLADLKRK
1an9A2          ----------------------------------------------------------------------
1d4cA2          AAGGMNAAETKPQAKL--------------GIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWL
2gqfA1          KILXSGGGFCTNLEVTPAHYLSQNPHFVKSALARTNWDFISLVAEQGITYHEKELGQLFC----------
1d7yA1          PPLSKDFMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVL-ATGAAPRAVL
1an9A1          TTTDVAAGLWQPYTSEPSNPQEAWNQQTFNYL-------LSHIG------SPNAANMGLTPVSGYNLFRE
2ivdA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRAGTIQPLAYVRGLAGAALKAGVRLHTASPVN
1ng3A1          RQMDDLDSVSWYSKEEVLEKE---PYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVL
1el5A1          AETMEAAKEHSLTVDLLEGDEINKGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVE
1pj5A2          LGYAAAWGIEGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESAGVTYRGSTTVT
1an9A2          ----------------------------------------------------------------------
1d4cA2          TSM------GADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQV--------LWDNAVKRGTDIRLNSRVV
2gqfA1          ------------------------------------DEGAEQI-----VEXLKSECDKYGAKILLRSEVS
1d7yA1          ANDALARAAGLACDDGIFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAV-------
1an9A1          AVPDPYWKDMVLGFRKLTPRELDMFPD---YRYGWFN-TSLILEGRKYLQWLTERLTERGVKFFKVESFE
2ivdA1          ---VEQLSVAATFPMLVKMEREHRSLILGAIRAQKAQRQAGTSGALSTFDGGLQVLIDAGDAAHVGARVE


                         .         .         .         +         .         .         .:280
query           ETGRNGAKWVVKTPEGSVTAKWIVVATEAYSTGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGC
1ng3A1          HVERDGEALFIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNADGKPYIGRHPEDSRILFAAGHFRNGIL
1el5A1          DFDISPDSVKIETANGSYTADKLIVSMGAWNS---KLLSKLNLDIPHFIIDLHPEHSNV-----------
1pj5A2          GIEQSGGRTGVQTADGVIPADIVVSCAGFWGAKIGAMIGMAVPPDGGPLLGESKELDGFYVAEAVWVTHS
1an9A2          -------------------------------------------------IKVDAPWLKNFIITHDLERGI
1d4cA2          RILEDASGKVTYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHPGATGDGLDVALQAGAAT
2gqfA1          QVEREKVRFVLQVNSTQWQCKNLIVAT-------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1an9A1          EVARGGADVII-----------------------------------------------------------
2ivdA1          GLAREGWRLIIEEHRAELSVAQVVLAAPAHAT--------------------------------------


                         .         *         .         .         .         .         +:350
query           WDTKEILSSFRMDKAGRLVFGSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVP
1ng3A1          LAPATGALISDLIMNKEVNQDWLHAFR-------------------------------------------
1el5A1          ----------------------------------------------------------------------
1pj5A2          AGVAKAMAELLTTGRSETDLGECDITRFEDVQLTP--------EYVSETSQQNFVEIYDVLHPLQPRLSP
1an9A2          YNS-----PYIIPGLQAVTLGGTFQVGNWNEINNIQDHNEGCCRLEPTLKDAKIVGEYTGFRPVR-----
1d4cA2          RDLEMGGLVIDTKAEVKSEKTG------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ng3A1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
1pj5A2          ----------------------------------------------------------------------
1an9A2          ----------------------------------------------------------------------
1d4cA2          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1an9A1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxx
1ng3A1          -------
1el5A1          -------
1pj5A2          -------
1an9A2          -------
1d4cA2          -------
2gqfA1          -------
1d7yA1          -------
1an9A1          -------
2ivdA1          -------