[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for atum0:AAK88515.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f2vA.bssp"
#ERROR : Can't open dsspfile "1ou0A.bssp"

## Summary of PDB Search
:210
    2e-75  72%  1f2vA  [c.23.17.1] PRECORRIN-8X METHYLMUTASE
    1e-26  32%  1ou0A  [c.23.17.1] PRECORRIN-8X METHYLMUTASE RELATED PROTEIN
:210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxDYDYIRDGNAIYERSFAIIREEADLSAFTEEQADIAIRMIHACGQVEAAGHFRFSPDFVSAARGALLA
1f2vA           --EYDYIRDGNAIYERSFAIIRAEADLSRFSEEEADLAVRMVHACGSVEATRQFVFSPDFVSSARAALKA
1ou0A           ----------------SLAAIDSXIDPDISGPXRH-IVVKAIHAAGDFAIAPLIRYSDGFFKSXLAKLKE


                         .         .         *         .         .         .         .:140
query           GKPVLCDAQMVAHGVTHARLPADNAVICTLRDPRTPELAKNIGNTRSXXXXXXXXXXXXXXXVAIGNAPT
1f2vA           GAPILCDAEMVAHGVTRARLPAGNEVICTLRDPRTPALAAEIGNTRSAAALKLWSERLAGSVVAIGNAPT
1ou0A           GCTIICDSEXVRAGIYSRPVLERNRVVCYLNDVRSKEXADVNGITRSAAGIRIAXQDHRNSVIVIGNAPT


                         +         .         .         .         .         *         .:210
query           ALFYLLEMLEKGGPRPAAIIGMPVGFVGAAESKDALEASALGIPYAIVKGRLGGSAMTAAAINAVARAGL
1f2vA           ALFFLLEMLRDGAPKPAAILGMPVGFVGAAESKDALAENSYGVPFAIVRGRLGGSAMTAAALNSLARPGL
1ou0A           ALLEAXRXIEENGWYDIPIVGIPVGFINASKAKEGLV--SSHIEYISVEGHRGGSPIAASIVNGFG----