[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bp441:dda

[Show Plain Result]

#ERROR : Can't open dsspfile "1w36D.bssp"
#ERROR : Can't open dsspfile "3gplA.bssp"
#ERROR : Can't open dsspfile "3gp8A.bssp"
#ERROR : Can't open dsspfile "3e1sA.bssp"

## Summary of PDB Search
:439
    1e-05  38%  1w36D  [c.37.1 - c.37.1] EXODEOXYRIBONUCLEASE V ALPHA CHAIN
    5e-05  28%  3gplA  [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD, PUTATIVE
    5e-05  28%  3gp8A  [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD, PUTATIVE
    5e-05  28%  3e1sA  [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD
:439

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVLAAPTHQAKKEL
1w36D           --------------------------------------------------------IRLAAPTGKAAARL
3gplA           ----------------------------------------------------------LCAPTGKAARRL
3gp8A           ----------------------------------------------------------LCAPTGKAARRL
3e1sA           ----------------------------------------------------------LCAPTGKAARRL


                         .         .         *         .         .         .         .:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
1w36D           TESALRQLPLTDEQKKRIPEDASTLHRLLHAGNP--LHLDVLVVDEASMIDLPMMSRLIDALPDHARVIF
3gplA           GEVTGRTASTVHRLLGYGPQGFRHNHL-------EPAPYDLLIVDEVSMMGDALMLSLLAAVPPGARVLL
3gp8A           GEVTGRTASTVHRLLGYGPQGFRHNHL-------EPAPYDLLIVDEVSMMGDALMLSLLAAVPPGARVLL
3e1sA           GEVTGRTASTVHRLLGYGPQGFRHNHL-------EPAPYDLLIVDEVSMMGDALMLSLLAAVPPGARVLL


                         +         .         .         .         .         *         .:210
query           IGDKAQIRGVSEDNETHELSPFFTDDRFSQVELDEVKRHQGPIIEVATDIRNGKxxxxxxxxxxxxxxxx
1w36D           LGDRDQLASV------------------------------------------------------------
3gplA           VGDTDQLPPVDAGXXXXXXXXXXXTIKLTQVYRQAAK---NPIIQAAHGLLHGE----------------
3gp8A           VGDTDQLPPVDAGXXXXXXXXXXXTIKLTQVYRQAAK---NPIIQAAHGLLHGE----------------
3e1sA           VGDTDQLPPVDAGXXXXXXXXXXXTIKLTQVYRQAAK---NPIIQAAHGLLHGE----------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w36D           ----------------------------------------------------------------------
3gplA           ----------------------------------------------------------------------
3gp8A           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w36D           ----------------------------------------------------------------------
3gplA           ----------------------------------------------------------------------
3gp8A           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
1w36D           ---------------------------------------AMTVHKSQGSEFDHAALILPSQ----RTPVV
3gplA           ----------------------------------------------------------------------
3gp8A           ----------------------------------------------------------------------
3e1sA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AQELIYVGNTRARENVxxx
1w36D           TRELVYTAVTRARRRL---
3gplA           -------------------
3gp8A           -------------------
3e1sA           -------------------