[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bp441:tk

[Show Plain Result]

#ERROR : Can't open dsspfile "2orwB.bssp"
#ERROR : Can't open dsspfile "2uz3B.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2qq0B.bssp"
#ERROR : Can't open dsspfile "2orwA.bssp"
#ERROR : Can't open dsspfile "2qq0A.bssp"
#ERROR : Can't open dsspfile "2qqeB.bssp"
#ERROR : Can't open dsspfile "2qqeA.bssp"
#ERROR : Can't open dsspfile "2ja1A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2qpoA.bssp"
#ERROR : Can't open dsspfile "2qpoD.bssp"
#ERROR : Can't open dsspfile "2qpoB.bssp"
#ERROR : Can't open dsspfile "2qpoC.bssp"
#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "2uz3A.bssp"
#ERROR : Can't open dsspfile "1w4rH.bssp"
#ERROR : Can't open dsspfile "1w4rA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "1xbtG.bssp"
#ERROR : Can't open dsspfile "1w4rF.bssp"
#ERROR : Can't open dsspfile "1w4rB.bssp"
#ERROR : Can't open dsspfile "2uz3C.bssp"
#ERROR : Can't open dsspfile "2orvA.bssp"
#ERROR : Can't open dsspfile "2j9rA.bssp"

## Summary of PDB Search
:191
    8e-13  31%  2orwB  [x.x.x] THYMIDINE KINASE
    7e-12  27%  2uz3B  [c.37.1 - g.39.1 (1xmrB)] THYMIDINE KINASE
    7e-12  27%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-11  32%  2qq0B  [x.x.x] THYMIDINE KINASE
    2e-11  32%  2orwA  [x.x.x] THYMIDINE KINASE
    4e-11  31%  2qq0A  [x.x.x] THYMIDINE KINASE
    1e-10  32%  2qqeB  [x.x.x] THYMIDINE KINASE
    1e-10  32%  2qqeA  [x.x.x] THYMIDINE KINASE
    1e-09  31%  2ja1A  [x.x.x] THYMIDINE KINASE
    9e-09  27%  2b8tC  [x.x.x] THYMIDINE KINASE
    4e-08  25%  2b8tD  [x.x.x] THYMIDINE KINASE
    5e-08  32%  2qpoA  [x.x.x] THYMIDINE KINASE
    8e-08  32%  2qpoD  [x.x.x] THYMIDINE KINASE
    2e-07  30%  2qpoB  [x.x.x] THYMIDINE KINASE
    5e-07  31%  2qpoC  [x.x.x] THYMIDINE KINASE
    5e-07  31%  3e2iA  [x.x.x] THYMIDINE KINASE
    3e-06  27%  2uz3A  [c.37.1 - g.39.1 (1xmrA)] THYMIDINE KINASE
    4e-06  31%  1w4rH  [x.x.x] THYMIDINE KINASE
    7e-06  30%  1w4rA  [x.x.x] THYMIDINE KINASE
    1e-05  27%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-05  32%  1xbtG  [c.37.1 - g.39.1] THYMIDINE KINASE, CYTOSOLIC
    2e-05  31%  1w4rF  [c.37.1 - g.39.1 (1xbtH)] THYMIDINE KINASE
    2e-05  31%  1w4rB  [x.x.x] THYMIDINE KINASE
    2e-05  27%  2uz3C  [c.37.1 - g.39.1 (1xmrC)] THYMIDINE KINASE
    2e-05  30%  2orvA  [x.x.x] THYMIDINE KINASE
    3e-05  30%  2j9rA  [x.x.x] THYMIDINE KINASE
:191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
2orwB           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPKIDT-------MIVSHGVEAHVIERPEEMRKY
2uz3B           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNY
2b8tA           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNY
2qq0B           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPK---------STMIVSHVEAHVIERPEEMRKY
2orwA           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPKHSTMIVSGV--------EAHVIERPEEMRKY
2qq0A           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKP----------KTMIVSHVEAHVIERPEEMRKY
2qqeB           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPKVE----------------AHVIERPEEMRKY
2qqeA           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKP------------KNGV--EAHVIERPEEMRKY
2ja1A           ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
2b8tC           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLPS-------VEVESAPEILNYI
2b8tD           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKP----KSIRNIQSRTGTSLPSVEVESAPEILNY
2qpoA           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKP-------------------AHVIERPEEMRKY
2qpoD           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKP------------KIGV--EAHVIERPEEMRKY
2qpoB           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPV-----------------EAHVIERPEEMRKY
2qpoC           ----------MYSGKTTELLSFVEIYKLGKKKVAVFKP------------------EAHVIERPEEMRKY
3e2iA           ------------SGKSEELIRRLRRGIYAKQKVVVFKPA---SHNGNAIEAINIS-KASEITHD------
2uz3A           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKISV----EVESAPEILNYIMSNSFNDETKV-
1w4rH           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTREALPACLLRDVAQEAL-----------
1w4rA           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCT--------HDRNTMEALPAC
2b8tB           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKI--LPSVEVESAPEILNYIMSNSFNDETKV-
1xbtG           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR-----------------YSSSEALPAC
1w4rF           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYALPACLLRDVAQEAL-----------
1w4rB           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR----YSSSFMEALPACLLR--------
2uz3C           ---IEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPK--SLPSVEVESAPEILNYIMSNSFNDETKV-
2orvA           ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYMEALPACL--------------LRDV
2j9rA           ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCV----------------KAVPVSASDIFKHI


                         .         .         *         .         .         .         .:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
2orwB           IE-----EDTRGVFIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2uz3B           IMSNSFNDETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
2b8tA           IMSNSFNDETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
2qq0B           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2orwA           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qq0A           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qqeB           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qqeA           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2ja1A           FEHITE--ELDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
2b8tC           MSNSFN-DETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
2b8tD           IMSNSFNDETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
2qpoA           IE-----EDTRGVFIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qpoD           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qpoB           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
2qpoC           IEE--DTRGV---FIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
3e2iA           ------LTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGL-DDFRGE--PFEPPKLAVSEQVTKL
2uz3A           ------------IGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
1w4rH           --------GVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
1w4rA           LLRDVEALGVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
2b8tB           ------------IGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
1xbtG           LLRDVEALGVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
1w4rF           --------GVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
1w4rB           -DVAQEALGVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
2uz3C           ------------IGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
2orvA           AQEAL---GVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
2j9rA           TEEM------DVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL


                         +         .         .         .         .         *         .:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKxxxxxx
2orwB           KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
2uz3B           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
2b8tA           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
2qq0B           KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
2orwA           KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
2qq0A           KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
2qqeB           KAVCHCGENATLTLKV----------AIDVGGQEKYIAVCR----------
2qqeA           KAVCHCGENATLTLKV--AGEE----EIDVGGQEKYIAVCR----------
2ja1A           QAVCVCGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
2b8tC           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
2b8tD           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
2qpoA           KAVCHCGENATLTL------------KVAGGEEEKYIAVCR----------
2qpoD           KAVCHCGENATLTLK------------------------------------
2qpoB           KAVCHCGENATLTLKVEKY--------------------------------
2qpoC           KAVCHCGENATLTLKV-----------------------------------
3e2iA           QAVCACGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
2uz3A           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
1w4rH           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
1w4rA           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
2b8tB           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
1xbtG           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
1w4rF           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
1w4rB           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
2uz3C           TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
2orvA           TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
2j9rA           QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------