[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bp441:vs.6

[Show Plain Result]

#ERROR : Can't open dsspfile "1mzoA.bssp"
#ERROR : Can't open dsspfile "1h16A.bssp"
#ERROR : Can't open dsspfile "1cm5A.bssp"
#ERROR : Can't open dsspfile "1r9dA.bssp"
#ERROR : Can't open dsspfile "2f3oA.bssp"

## Summary of PDB Search
:122
    9e-26  78%  1mzoA  [c.7.1] PYRUVATE FORMATE-LYASE
    9e-26  78%  1h16A  [c.7.1] FORMATE ACETYLTRANSFERASE 1
    9e-26  78%  1cm5A  [c.7.1] PROTEIN (PYRUVATE FORMATE-LYASE)
    3e-09  45%  1r9dA  [c.7.1] GLYCEROL DEHYDRATASE
    8e-06  38%  2f3oA  [x.x.x] PYRUVATE FORMATE-LYASE 2
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEPTVEGGQHLNV
1mzoA           ----------------------------------------------------------EASIEGGQHLNV
1h16A           ----------------------------------------------------------EASIEGGQHLNV
1cm5A           ----------------------------------------------------------EASIEGGQHLNV
1r9dA           ----------------------------------------------------------------GFHVQF
2f3oA           ---------------------------------------------------------------GVMHVQF


                         .         .         *         .         .         .         .:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQSL
1mzoA           NVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
1h16A           NVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
1cm5A           NVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
1r9dA           NVIDKKILLAAQKNPEKYQDLIVRVAGYSAQFISLDKSIQNDIIART-----
2f3oA           NILKEDLLRKAQQEPEKYRWLLVRVAGWSAYFVELSRPVQEEVIRR------