[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bp441:30.2

[Show Plain Result]

#ERROR : Can't open dsspfile "1l6rA.bssp"

## Summary of PDB Search
:234
    1e-04  30%  1l6rA  [c.108.1] HYPOTHETICAL PROTEIN TA0175
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMREYNNS
1l6rA           -------IMFDNDGSIKKFFSGTNKFLEEMSKRTS--MRSILTNRWREASTGFDIDPEDVDYVRKEAESR


                         .         .         *         .         .         .         .:140
query           DFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l6rA           GFVIFYSGYEDKAFAVNKLKEMYEYDEILVIGDSN-----------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l6rA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxx
1l6rA           ------------------------