[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for bp441:cd

[Show Plain Result]

#ERROR : Can't open dsspfile "1vq2A.bssp"
#ERROR : Can't open dsspfile "2hvwB.bssp"
#ERROR : Can't open dsspfile "2hvwA.bssp"
#ERROR : Can't open dsspfile "2hvvA.bssp"
#ERROR : Can't open dsspfile "2w4lE.bssp"
#ERROR : Can't open dsspfile "2w4lB.bssp"
#ERROR : Can't open dsspfile "2w4lF.bssp"
#ERROR : Can't open dsspfile "2w4lA.bssp"
#ERROR : Can't open dsspfile "2w4lD.bssp"
#ERROR : Can't open dsspfile "2w4lC.bssp"
#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "1wwrD.bssp"
#ERROR : Can't open dsspfile "1wwrC.bssp"
#ERROR : Can't open dsspfile "1wwrB.bssp"
#ERROR : Can't open dsspfile "1wwrA.bssp"
#ERROR : Can't open dsspfile "2o7pA.bssp"
#ERROR : Can't open dsspfile "2a8nB.bssp"
#ERROR : Can't open dsspfile "2a8nA.bssp"
#ERROR : Can't open dsspfile "2obcA.bssp"
#ERROR : Can't open dsspfile "2g6vA.bssp"
#ERROR : Can't open dsspfile "1wkqB.bssp"
#ERROR : Can't open dsspfile "1wkqA.bssp"
#ERROR : Can't open dsspfile "2obcB.bssp"
#ERROR : Can't open dsspfile "2g6vB.bssp"
#ERROR : Can't open dsspfile "2hxvA.bssp"

## Summary of PDB Search
:172
    7e-56  65%  1vq2A  [c.97.1] DEOXYCYTIDYLATE DEAMINASE
    5e-20  39%  2hvwB  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    5e-20  39%  2hvwA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    5e-20  39%  2hvvA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    7e-14  43%  2w4lE  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    9e-14  44%  2w4lB  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    1e-13  44%  2w4lF  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    1e-13  44%  2w4lA  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    3e-12  46%  2w4lD  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    1e-11  49%  2w4lC  [x.x.x] DEOXYCYTIDYLATE DEAMINASE
    8e-07  52%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    8e-07  52%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-06  44%  1wwrD  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-06  44%  1wwrC  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-06  44%  1wwrB  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-06  44%  1wwrA  [x.x.x] TRNA ADENOSINE DEAMINASE TADA
    1e-06  36%  2o7pA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    5e-06  43%  2a8nB  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    5e-06  43%  2a8nA  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    2e-05  36%  2obcA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-05  37%  2g6vA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-04  39%  1wkqB  [c.97.1] GUANINE DEAMINASE
    2e-04  39%  1wkqA  [c.97.1] GUANINE DEAMINASE
    2e-04  36%  2obcB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-04  37%  2g6vB  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    5e-04  49%  2hxvA  [x.x.x] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE
:172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
1vq2A           MKASTVLQIAYLVSQESKCCSWKVGAVIEKNGRIISTGYNGSPAGG-VNCCDYAAEQGWLLNKRFVLAKE
2hvwB           ------MANAELISKRSTCNRAYVGAVLVKNNRIIATGYNGGVADT-DNCDDVGH-----EMEDGHC---
2hvwA           ------MANAELISKRSTCNRAYVGAVLVKNNRIIATGYNGGVADT-DNCDDVGH-----EMEDGHC---
2hvvA           ------MANAELISKRSTCNRAYVGAVLVKNNRIIATGYNGGVADT-DNCDDVGH-----EMEDGHC---
2w4lE           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDVLP--WRRTAENKLDTK
2w4lB           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDVLP--WRRTAENKLDTK
2w4lF           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDVLP--WRRTAENKLDTK
2w4lA           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDVLP--WRRTAENKLDTK
2w4lD           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----C-----VLPWRRTAENKTKYP
2w4lC           ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDV-----LPPYV------
2b3zD           -----------------------VGAVVVKDGQIVGMG--------------------------------
2b3zA           -----------------------VGAVVVKDGQIVGMG--------------------------------
1wwrD           -----------------------VGAIIVKEGEIISKAHNSV---------EELK-----DPT-------
1wwrC           -----------------------VGAIIVKEGEIISKAHNSV---------EELK-----DPT-------
1wwrB           -----------------------VGAIIVKEGEIISKAHNSV---------EELK-----DPT-------
1wwrA           -----------------------VGAIIVKEGEIISKAHNSV---------EELK-----DPT-------
2o7pA           -----------------------VGCVIVKDGEIVGEGY-------------HQRAG-------------
2a8nB           ----------------------------------------------------------------------
2a8nA           ----------------------------------------------------------------------
2obcA           -----------------------VGCVIVKDGEIVGEGY-------------HQRAG-------------
2g6vA           -----------------------VGCVIVKDGEIVGEGY-------------HQRAG-------------
1wkqB           ------------------------GAVIVKDGAIIAEGQNNVTTSN--------------DPTA------
1wkqA           ------------------------GAVIVKDGAIIAEGQNNVTTSN--------------DPTA------
2obcB           -----------------------VGCVIVKDGEIVGEGY-------------HQRAG-------------
2g6vB           -----------------------VGCVIVKDGEIVGEGY-------------HQRAG-------------
2hxvA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPG
1vq2A           HRSAHSEWSSKNEIHAELNAILFAAENGSSIEGATMYVTLSPCPDCAKAIAQSGIKKLVYCETYDKNKPG
2hvwB           ----------IRTVHAEMNALIQCAKEGISANNTEIYVTHFPCINCTKALLQAGVKKITYNTAY-RIHPF
2hvwA           ----------IRTVHAEMNALIQCAKEGISANNTEIYVTHFPCINCTKALLQAGVKKITYNTAY-RIHPF
2hvvA           ----------IRTVHAEMNALIQCAKEGISANNTEIYVTHFPCINCTKALLQAGVKKITYNTAY-RIHPF
2w4lE           YPYV---------CHAELNAIMN--KNLTDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
2w4lB           YPYV---------CHAELNAIM-----NKDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
2w4lF           YPYV---------CHAELNAIM------NDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
2w4lA           YPYV---------CHAELNAIM------NDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
2w4lD           Y-----------VCHAELNAIMNKVK------GCSMYVALFPCNECAKLIIQAGIKEVIF----------
2w4lC           -------------CHAELNAIMNKVK------GCSMYVALFPCNECAKLIIQAGIKEVIF----------
2b3zD           ---AHLKYG---EAHAEVHAIHMA---GAHAEGADIYVTLEPCSHCAELIINSGIKRVF-----------
2b3zA           ---AHLKYG---EAHAEVHAIHMA---GAHAEGADIYVTLEPCSHCAELIINSGIKRVF-----------
1wwrD           ---AHAEMLAIKEACRRLNT--------KYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSAL-------
1wwrC           ---AHAEMLAIKEACRRLNT--------KYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSAL-------
1wwrB           ---AHAEMLAIKEACRRLNT--------KYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSAL-------
1wwrA           ---AHAEMLAIKEACRRLNT--------KYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSAL-------
2o7pA           ------------EPHAEVHAL----RAGEKAKGATAYVTLEPCPPCCDALIAAGVARVVASQDPNQVAGR
2a8nB           --------------HAEIAVIRMACEAGQELPGADLYVTLEPCTMCAAAISFARIRRLYY----------
2a8nA           --------------HAEIAVIRMACEAGQELPGADLYVTLEPCTMCAAAISFARIRRLYY----------
2obcA           ------------EPHAEVHAL----RAGEKAKGATAYVTLEPC-PCCDALIAAGVARVVASQDPNQVAGR
2g6vA           ------------EPHAEVHAL----RAGEKAKGATAYVTLEPC-PCCDALIAAGVARVVASQDPNPQVAG
1wkqB           --------------HAEVTAIRKACKGAYQLDDCILYTSCEPCPMCLGAIYWARPKAVFYAEHTDAAEAG
1wkqA           --------------HAEVTAIRKACKGAYQLDDCILYTSCEPCPMCLGAIYWARPKAVFYAEHTDAAEAG
2obcB           ------------EPHAEVHAL----RAGEKAKGATAYVTLEPCSD---ALIAAGVARVVASQDPNQVAGR
2g6vB           ------------EPHAEVHAL----RAGEKAKGATAYVTLEPCSD---ALIAAGVARVVASQDPNPQVAG
2hxvA           --------------HAE-RAIESARKKGEDLRGATLIVTLEPCDHCTDLIIESGIKTV------------


                         +         .         .         .         .         *         .:210
query           WDEILVKSGIKVIHNKVPLNLLKKEFxxxxxx
1vq2A           WDDILRNAGIEVFN--VPKKNLNK--------
2hvwB           AIELMTQKEVEYVQHDVP--------------
2hvwA           AIELMTQKEVEYVQHDVP--------------
2hvvA           AIELMTQKEVEYVQHDVP--------------
2w4lE           --------------------------------
2w4lB           --------------------------------
2w4lF           --------------------------------
2w4lA           --------------------------------
2w4lD           --------------------------------
2w4lC           --------------------------------
2b3zD           --------------------------------
2b3zA           --------------------------------
1wwrD           --------------------------------
1wwrC           --------------------------------
1wwrB           --------------------------------
1wwrA           --------------------------------
2o7pA           GLYRLQQAGIDVSHGLSEAEQLNKGF------
2a8nB           --------------------------------
2a8nA           --------------------------------
2obcA           GLYRLQQAGIDVSHGLSEAEQLNKGF------
2g6vA           RGLYLQQAGIDVSHGLSEAEQLNKGF------
1wkqB           FDDSFI--------------------------
1wkqA           FDDSFI--------------------------
2obcB           GLYRLQQAGIDVSHGLSEAEQLNKGF------
2g6vB           RGLYLQQAGIDVSHGLSEAEQLNKGF------
2hxvA           --------------------------------