[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81341.1

[Show Plain Result]


## Summary of Sequence Search
    1::439
    1::439     e-107  49%  439 aa  DDA_BPT4 RecName: Full=ATP-dependent DNA helicase dda;       
  535::577     3e-05  53%  608 aa  EX5A_ECOLI RecName: Full=Exodeoxyribonuclease V alpha chain;       
  555::609     3e-04  36%  640 aa  EX5A_HAEIN RecName: Full=Exodeoxyribonuclease V alpha chain;       
  236::578     3e-04  25%  602 aa  EX5A_BUCAI RecName: Full=Exodeoxyribonuclease V alpha chain;       
    1::439

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAXXXXXXXXXXXXDRLFQTGQQGIVLAAPTHQAKKEL
DDA_BPT4        -MTFDDLTEGQKNAFNIVMKAIKEKKHVTINGPAGTGKTTLTKFIIEALISTGGTGIILAAPTHAAKKIL
EX5A_ECOLI      ----------------------------------------------------------------------
EX5A_HAEIN      ----------------------------------------------------------------------
EX5A_BUCAI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
DDA_BPT4        SKLSGKEASTIHSILKINPVTYEENVLFEQKEVPDLAKCRVLICDEVSMYDRKLFKILLSTIPPWCTIIG
EX5A_ECOLI      ----------------------------------------------------------------------
EX5A_HAEIN      ----------------------------------------------------------------------
EX5A_BUCAI      -------ATTIHQLLGIQK--ISQKSFFNKSNCLDLD---VLIIDEISMVDILMMEKILSSISKNTKLIF


                         +         .         .         .         .         *         .:210
query           IGDKAQIRGVSEDNETHELSPFFTDDRFSQVELDEVKRHQGPIIEVATDIRNGKWIYEKLDEHGNGVKQY
DDA_BPT4        IGDNKQIRPVEPGENTAYISPFFTHKDFYQCELTEVKRSNAPIIDVATDVRNGKWNYDKVDGHGRGFTGD
EX5A_ECOLI      ----------------------------------------------------------------------
EX5A_HAEIN      ----------------------------------------------------------------------
EX5A_BUCAI      IGDHNQLGPIESGNDGYSFKSMISIEKLTQYKLKKINKKTTNFISDNICVLNKNYRFNK----NSGIYTL


                         .         .         .         +         .         .         .:280
query           HSVKDFLGVYFNRTKKPEDLFENRIMAYTNASVDKLNAVIRKKLYGSDVAPFLPGEILVMQEPLMFEIDV
DDA_BPT4        TALRDFMVNYFSIVKSLDDLFENRVMAFTNKSVDKLNSIIRKKIFETD-KDFIVGEIIVMQEPLFKTYKI
EX5A_ECOLI      ----------------------------------------------------------------------
EX5A_HAEIN      ----------------------------------------------------------------------
EX5A_BUCAI      SNA-----IFKKKTRIIESLFDNNIFFYETNSSEQYKKMIKN---------------ICLNYEDFWEKIY


                         .         *         .         .         .         .         +:350
query           GGQTLKEVIFSNGQNVQILNVKPSRKKLVAKNVGEIEVEYIMLECETHDEDEDDYKRAWFSVIADDNTAQ
DDA_BPT4        DGKPVSEIIFNNGQLVRIIEAEYTSTFVKARGVGEYLIRHWDLTVETYGDDE--YYREKIKIISSDEELY
EX5A_ECOLI      ----------------------------------------------------------------------
EX5A_HAEIN      ----------------------------------------------------------------------
EX5A_BUCAI      KKATMKEIIESF-QNYQVLGVNIINKKLEENMYKKNIIKYFYIDGEE-----------WYIMIINNNRAL


                         .         .         .         .         *         .         .:420
query           AISEFLSIIADKYRSRAVFPAWKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
DDA_BPT4        KFNLFLAKTAETYKNKGGKAPWSDFWDAKSQFSKVKALPASTFHKAQGMSVDRAFIYTPCIH--YADVEL
EX5A_ECOLI      ---------------------------------------AMTVHKSQGSEFDHAALILPSQ----RTPVV
EX5A_HAEIN      ---------------------------LTNRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTE----VNPVL
EX5A_BUCAI      NVSXXXXXXXXXXXXXXLQVSFKENNTINNIPVKIKTAWAITVHKSQGSEFMNTALILPNFNSHILNKDT


                         .         .         +         .         .         .         .:490
query           AQELIYVGNTRARENVGFV
DDA_BPT4        AQQLLYVGVTRGRYDVFYV
EX5A_ECOLI      TRELVYTAVTRARRRL---
EX5A_HAEIN      SRELVFTGVTRAKKEL---
EX5A_BUCAI      ----LYTGITRSRK-----