[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81348.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    1::125     5e-15  40%  138 aa  END5_BPT4 RecName: Full=Endonuclease V;         EC=3.1.25.1;
 1167::1286    4e-04  24% 3433 aa  UTRO_HUMAN RecName: Full=Utrophin;AltName: Full=Dystrophin-related
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHVTFFYNKLAWL
END5_BPT4       MTRINLTLVSELADQHLMAEYRELPRVFGA-VRKHVANGKRVRDFKISPTFIL--GAGHVTFFYDKLEFL
UTRO_HUMAN      ----------------------EMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGGQE----LTSELNVV


                         .         .         *         .         .         .         .:140
query           RDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRTRIAEMIPEKHKLTNEQLEKL
END5_BPT4       RKRQIELIAECLKRGFNIKDTTVQDISIPQ--EFRGDYIPHEASIAISQARLDEKIAQR-----------
UTRO_HUMAN      LENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEE----RMKSTEVLPEKTDAVNEALESL


                         +         .         .         .         .         *         .:210
query           SAIAEYEAFNxx
END5_BPT4       ------------
UTRO_HUMAN      ESVLRHPADN--