[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81374.1

[Show Plain Result]


## Summary of Sequence Search
    1::262
  203::266     7e-05  28%  557 aa  NFL_XENTR RecName: Full=Neurofilament light polypeptide;       
    1::262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHVEKTLEKIYNPYVP
NFL_XENTR       ------------------------------------------------------VELEKRMDSLLDEIAF


                         .         .         *         .         .         .         .:140
query           TQKVKVEKMAQVSSQLQYEDLNCDVRVVSSEYANANARDLAKYSKLSSxxxxxxxxxxxxxxxxxxxxxx
NFL_XENTR       LKKVHEEELAQLQSQVQYAQISLEVEVAKPDLSSALRDIRAQYEKLAA----------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NFL_XENTR       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NFL_XENTR       ----------------------------------------------------