[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81406.1

[Show Plain Result]


## Summary of Sequence Search
    1::105
  225::318     9e-04  32%  631 aa  GLMS_SYNY3 RecName: Full=Glucosamine--fructose-6-phosphate
    1::105

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxLGVEASEFKMPSVWKVARKPDWSYGAVFEQEFTAYEHKELGCFVAVYSERHRAQFVN
GLMS_SYNY3      -------------LGVEVYDFNLKRVRKLPRTLDWSATTVEKQGFRHFMLKEITCLATYLNEQWRAADHP


                         .         .         *         .         .         .         .:140
query           TEGEDVIGHTERVVSVQHVEPYKTRLGTSWxxxxx
GLMS_SYNY3      SHSPVFLGLDPQLTNLQHIQ--VLACGTSW-----