[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81419.1

[Show Plain Result]


## Summary of Sequence Search
    1::191
    1::188     6e-51  51%  193 aa  KITH_IDILO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-50  52%  195 aa  KITH_MANSM RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-50  51%  192 aa  KITH_VIBF1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-50  52%  192 aa  KITH_VIBPA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-50  52%  192 aa  KITH_VIBCH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-50  52%  192 aa  KITH_PHOPR RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-50  53%  198 aa  KITH_HAEDU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     4e-50  52%  192 aa  KITH_VIBVU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::194     4e-50  49%  209 aa  KITH_LEGPL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     5e-50  52%  192 aa  KITH_VIBVY RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::194     2e-49  49%  209 aa  KITH_LEGPA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::193     4e-49  48%  209 aa  KITH_LEGPH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     9e-49  51%  193 aa  KITH_HAEIN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     9e-49  51%  193 aa  KITH_HAEI8 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::193     2e-48  51%  211 aa  KITH_RHOBA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-48  50%  192 aa  KITH_PASMU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::187     5e-48  51%  194 aa  KITH_PSEHT RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     6e-48  49%  205 aa  KITH_SHIDS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     6e-48  51%  195 aa  KITH_JANSC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::191     2e-47  48%  196 aa  KITH_COXBU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-47  50%  196 aa  KITH_YERPS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-47  50%  196 aa  KITH_YERPE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_SHISS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_SHIFL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_SHIBS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::187     3e-47  48%  198 aa  KITH_ERWCT RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_ECOLI RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_ECOL6 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     3e-47  49%  205 aa  KITH_ECO57 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-46  48%  205 aa  KITH_SALTY RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-46  48%  205 aa  KITH_SALTI RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-46  48%  205 aa  KITH_SALPA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-46  48%  205 aa  KITH_SALCH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     3e-46  51%  209 aa  KITH_XANAC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::187     4e-46  50%  193 aa  KITH_BPT4 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     6e-46  51%  209 aa  KITH_XANC5 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     7e-46  48%  193 aa  KITH_AGRT5 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-45  48%  198 aa  KITH_SILPO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     2e-45  51%  209 aa  KITH_XANOR RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     2e-45  51%  209 aa  KITH_XANOM RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-45  48%  192 aa  KITH_SHEON RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     4e-45  46%  201 aa  KITH_PHOLL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::190     6e-45  50%  195 aa  KITH_RHIME RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     2e-44  46%  192 aa  KITH_NOVAD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     3e-43  47%  200 aa  KITH_RHIEC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     6e-43  44%  192 aa  KITH_COLP3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     8e-43  48%  209 aa  KITH_XANCP RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     8e-43  48%  209 aa  KITH_XANC8 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::188     1e-42  45%  193 aa  KITH_ZYMMO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::187     3e-41  48%  203 aa  KITH_RHILO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::194     2e-40  46%  197 aa  KITH_FRATT RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::194     3e-40  46%  197 aa  KITH_FRATH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     8e-40  42%  205 aa  KITH_BLOPB RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     1e-39  47%  189 aa  KITH_STRP3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-39  47%  189 aa  KITH_STRPM RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-39  47%  189 aa  KITH_STRP8 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-39  47%  189 aa  KITH_STRP6 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-39  47%  189 aa  KITH_STRP1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    4::187     2e-39  45%  194 aa  KITH_STRMU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     5e-39  46%  191 aa  KITH_STRGC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::191     5e-39  47%  197 aa  KITH_LACSS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     9e-39  45%  198 aa  KITH_STRT2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     9e-39  45%  196 aa  KITH_STRT1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::187     2e-37  41%  192 aa  KITH_BLOFL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-37  45%  199 aa  KITH_STRR6 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     2e-37  45%  199 aa  KITH_STRPN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     3e-37  45%  189 aa  KITH_STRA5 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     3e-37  45%  189 aa  KITH_STRA3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     3e-37  45%  189 aa  KITH_STRA1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::183     4e-37  43%  191 aa  KITH_LISMF RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::183     5e-37  43%  191 aa  KITH_LISMO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::183     5e-37  43%  191 aa  KITH_LISIN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::189     2e-36  43%  189 aa  KITH_LACLA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::179     2e-36  46%  184 aa  KITH_CHRVO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     3e-36  43%  192 aa  KITH_LACPL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::183     4e-36  44%  192 aa  KITH_BACSK RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::180     9e-36  47%  197 aa  KITH_RHOFD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::192     2e-35  42%  199 aa  KITH_LACJO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::192     3e-35  42%  199 aa  KITH_LACAC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::184     3e-34  42%  194 aa  KITH_ENTFA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    6::189     2e-22  34%  212 aa  KITH_ENCCU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::194     1e-21  34%  216 aa  KITH_PROAC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::157     9e-18  35%  216 aa  KITH_STRAW RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    1::157     1e-17  35%  216 aa  KITH_STRCO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    9::181     2e-16  32%  185 aa  KITH_PYRAE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    4::174     4e-14  30%  185 aa  KITH_THELT RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    4::174     6e-14  31%  184 aa  KITH_THEP1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::191     6e-14  29%  197 aa  KITH_PYRKO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   12::174     8e-14  31%  184 aa  KITH_THESQ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   12::174     8e-14  31%  184 aa  KITH_THEMA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   10::175     2e-12  31%  182 aa  KITH_AMEPV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   21::196     2e-11  27%  223 aa  KITH_UREU1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAAW RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAAS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAAR RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAAC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAAB RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-11  29%  199 aa  KITH_STAA3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   22::186     3e-11  30%  191 aa  KITH_MYCPN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   21::196     3e-11  27%  223 aa  KITH_UREPA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   21::196     3e-11  27%  223 aa  KITH_UREP2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     3e-11  29%  199 aa  KITH_STAAN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     3e-11  29%  199 aa  KITH_STAAM RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::186     5e-11  35%  193 aa  KITH_THEPX RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::186     5e-11  35%  193 aa  KITH_THEP3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   27::200     5e-11  29%  209 aa  KITH_MYCCT RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     6e-11  30%  194 aa  KITH_BACLD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    6::178     1e-10  29%  183 aa  KITH_FOWPV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     1e-10  29%  194 aa  KITH_BACA2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     2e-10  30%  192 aa  KITH_CLOTE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   10::180     4e-10  30%  185 aa  KITH_CFEPV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::188     5e-10  34%  209 aa  KITH_ONYPE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     7e-10  28%  199 aa  KITH_STAHJ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     9e-10  29%  199 aa  KITH_STAES RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     9e-10  29%  199 aa  KITH_STAEQ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::189     9e-10  28%  194 aa  KITH_MYCA5 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::186     1e-09  29%  193 aa  KITH_THETN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   10::181     1e-09  30%  186 aa  KITH_CBEPV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     1e-09  30%  199 aa  KITH_STAS1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     1e-09  30%  195 aa  KITH_CLOAB RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     1e-09  31%  206 aa  KITH_ANOFW RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::188     2e-09  29%  200 aa  KITH_MYCMO RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     2e-09  31%  191 aa  KITH_CLOBJ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     2e-09  31%  191 aa  KITH_CLOB6 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     2e-09  29%  204 aa  KITH_BACHD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     3e-09  30%  207 aa  KITH_OCEIH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     3e-09  31%  191 aa  KITH_CLOBM RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::169     3e-09  33%  212 aa  KITH_DEIRA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     3e-09  31%  195 aa  KITH_BACC4 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   68::250     4e-09  32%  271 aa  KITH_ORYSJ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     4e-09  30%  205 aa  KITH_GEOSW RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     4e-09  31%  191 aa  KITH_CLOBL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     4e-09  31%  191 aa  KITH_CLOBK RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     4e-09  31%  191 aa  KITH_CLOBH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     4e-09  31%  191 aa  KITH_CLOB1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  195 aa  KITH_BACCZ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  195 aa  KITH_BACCR RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  195 aa  KITH_BACC2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  194 aa  KITH_BACAN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  194 aa  KITH_BACAC RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     4e-09  31%  194 aa  KITH_BACAA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACHK RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACCQ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACC7 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACC3 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACC1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  194 aa  KITH_BACC0 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     6e-09  31%  195 aa  KITH_BACAH RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::195     7e-09  27%  195 aa  KITH_BACSU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     7e-09  27%  194 aa  KITH_BACCN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::185     1e-08  29%  198 aa  KITH_COPPD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   21::193     2e-08  28%  224 aa  KITH_MYCGA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::184     2e-08  29%  194 aa  KITH_BACWK RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   18::188     3e-08  32%  209 aa  KITH_AYWBP RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     4e-08  28%  207 aa  KITH_GEOTN RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::179     5e-08  29%  184 aa  KITH_MYCHJ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::179     5e-08  29%  184 aa  KITH_MYCH7 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::179     5e-08  29%  184 aa  KITH_MYCH2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   22::188     6e-08  28%  213 aa  KITH_MYCGE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    9::180     6e-08  30%  227 aa  KITH_DICDI RecName: Full=Thymidine kinase 1;         Short=TK1;    
    7::174     8e-08  26%  178 aa  KITH_MYXVL RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::186     8e-08  27%  207 aa  KITH_GEOKA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    5::188     8e-08  25%  195 aa  KITH_BACNA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::193     1e-07  30%  220 aa  KITH_MYCPE RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-07  26%  193 aa  KITH_ROSS1 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-07  26%  191 aa  KITH_MACCJ RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    7::174     3e-07  26%  178 aa  KITH_MYXVU RecName: Full=Thymidine kinase;         EC=2.7.1.21;
    6::172     4e-07  29%  176 aa  KITH_RFVKA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   28::186     2e-06  34%  233 aa  KITH_MOUSE RecName: Full=Thymidine kinase, cytosolic;       
   18::197     2e-06  28%  202 aa  KITH_DEIDV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   16::186     2e-06  29%  200 aa  KITH_BACP2 RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   27::199     3e-06  24%  209 aa  KITH_MYCMS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   28::196     3e-06  31%  234 aa  KITH_CRIGR RecName: Full=Thymidine kinase, cytosolic;       
   17::186     1e-05  27%  193 aa  KITH_CHLAD RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::187     2e-05  26%  194 aa  KITH_ROSCS RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   19::185     2e-05  27%  204 aa  KITH_BDEBA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   28::186     2e-05  30%  234 aa  KITH_HUMAN RecName: Full=Thymidine kinase, cytosolic;       
   10::182     4e-05  25%  225 aa  KITH_MIMIV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::186     4e-05  29%  193 aa  KITH_CHLSY RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   17::186     4e-05  29%  193 aa  KITH_CHLAA RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   25::187     4e-05  28%  224 aa  KITH_CHICK RecName: Full=Thymidine kinase, cytosolic;       
   13::172     5e-05  29%  177 aa  KITH_MONPV RecName: Full=Thymidine kinase;         EC=2.7.1.21;
   28::186     2e-04  32%  238 aa  KITH_BOVIN RecName: Full=Thymidine kinase, cytosolic;       
  145::219     5e-04  36%  450 aa  DNAA_MYCMS RecName: Full=Chromosomal replication initiator protein
    1::191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
KITH_IDILO      MASLYFTYSAMNAGKSTSLLQVAHNYEERQQHVLLMTPALDDRAGKGIASRLGIGRDAVSFTHRTDLAAV
KITH_MANSM      MAKLYFYYSTMNAGKSTTLLQSAYNYNERNMNTLVYTAAIDDRFGGRVTSRIGISQQAKLFNRESNLFEE
KITH_VIBF1      MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPAIFTAAIDDRYGGKVSSRIGLHAEAHLFNKETNVFDA
KITH_VIBPA      MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGGKVSSRIGLQSDAHLFRPDTNLYQE
KITH_VIBCH      MAQMYFYYSAMNAGKSTTLLQSAFNYQERGMNPLIFTAAIDDRFGGKVSSRIGLEAEAHLFHADTDLLHV
KITH_PHOPR      MAQMYFYYSAMNAGKSTTLLQSSFNYRERGMRPVIFTAAIDDRFGTGVSSRIGLEEDAELYNKSDDLWSK
KITH_HAEDU      MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGGKVCSRIGISQEAKLFYTDTNFLEQ
KITH_VIBVU      MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGGKVSSRIGLQAEAQLFKADTNLYQE
KITH_LEGPL      MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRQYGTICSRIGLSEQAYAFNNTDNLYVL
KITH_VIBVY      MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGGKVSSRIGLQAEAQLFKADTNLYQE
KITH_LEGPA      MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRQYGTICSRIGLSEQAYAFNNSDNLYVL
KITH_LEGPH      MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRQYGTICSRIGLSEQAYAFNNSDNLYVL
KITH_HAEIN      MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRFGGKVTSRIGISQDAFLFRSETNLFDE
KITH_HAEI8      MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMSTLVYTAAIDDRFGGKVTSRIGISQDAFLFRSETNLFDE
KITH_RHOBA      MAKLYFYYSTMNAGKSTVLLQSSYNYRERGMNTLILSPEIDTRFGSGVASRIGIESESVSFNTSDNLLNL
KITH_PASMU      MAKLYFYYSTMNAGKSTTLLQSSYNYQERDMNTLVYTAAIDDRFGGKVTSRIGISQEAQLFHKESDLFVE
KITH_PSEHT      MAQLYFYYSAMNAGKSTTLLQSAFNYQERGMEPVILTAAIDDRAGGKVSSRIGLQADAHIFDENKDVFAL
KITH_SHIDS      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFAE
KITH_JANSC      MAKLYFNYSTMNAGKSTLLLQASYNYIERGMQTYLLTANFDDRAGGRIGSRIGIEAEADTYTQSDDLFAK
KITH_COXBU      MAKLHFYYSAMNAGKSTTLLQSSYNYNERGMDTLVFLPVVDDREGERIATRIGLSGKTIALTKDTNLKCI
KITH_YERPS      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGGTVSSRIGLSSQAQLYNSGTSLLSI
KITH_YERPE      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGGTVSSRIGLSSQAQLYNSGTSLLSI
KITH_SHISS      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_SHIFL      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_SHIBS      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_ERWCT      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRHGVGVSSRIGLSSPALLFNRQTSLFEL
KITH_ECOLI      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_ECOL6      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_ECO57      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNSSLFDE
KITH_SALTY      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNTSLFEE
KITH_SALTI      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNTSLFEE
KITH_SALPA      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNTSLFEE
KITH_SALCH      MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGGKVSSRIGLSSPAKLFNQNTSLFEE
KITH_XANAC      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVASRIGLRADGRIFERDTELQQL
KITH_BPT4       MASLIFTYAAMNAGKSASLLIAAHNYKERGMSVLVLKPAIDTRDSVEVVSRIGIKQEANIITDDMDIFEF
KITH_XANC5      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVASRIGLRADGRIFERDTELQQL
KITH_AGRT5      MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDDRAGGRVASRIGLSSEARTFDENTDLFAE
KITH_SILPO      MAKLYFNYSTMNAGKSTVLLQASHNYRERGMQTYLMTAAIDGRAGTGIASRIGIGAEADIFTPRDDVFAM
KITH_XANOR      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVASRIGLRADGRIFERDTGLQQL
KITH_XANOM      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTLILTPKLDHRAGSGVASRIGLRADGRIFERDTGLQQL
KITH_SHEON      MAQLYFYYSAMNAGKSTSLLQSSYNYRERGMNTLVMTASIDDRYGKGVASRIGIESDAQVFSSHDNLIEM
KITH_PHOLL      MAQLYFYYSAMNAGKSTSLLQSSYNYNERGMRTLVFTAEIDTRENGKVNSRIGLSSDALLFSQQTDIGEL
KITH_RHIME      MSKLYFSYATMNAGKSTLLLQAAYNYQERGMRVVMLIAAFDDRAGQGIASRIGLESEAIPFRAEDDLHGL
KITH_NOVAD      MAKLYFYYASMNAGKSTNLLQADFNYRERGMATMLWTAALDDRGGERIESRIGLGADAHRFDAGTDLWQR
KITH_RHIEC      MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVGSRIGLEASAIPFEPDEDLFRL
KITH_COLP3      MAQLYFYYSSMNAGKSTHLLQSSYNYQERGLVTAIYTAKIDDRFAKGVASRLGIDADAFLFDEKINLFKD
KITH_XANCP      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTSILTPKLDHRAGSGVASRIGLRADGQTFDRQTELLQL
KITH_XANC8      MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRTSILTPKLDHRAGSGVASRIGLRADGQTFDRQTELLQL
KITH_ZYMMO      MAKLYFYYASMNAGKSTNLLQADFNYRERGMQTLLFTAGIDTRYKQGVKSRIGLEAPAIAFFEESSLWDI
KITH_RHILO      MAKLYFNYATMNAGKTTMLLQASYNYRERGMTTMLFV-AGHYRKGDSISSRIGLETEAEMFRDGDDLFAR
KITH_FRATT      MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNVKSRIGINQDAYSLTDRDNIFEF
KITH_FRATH      MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNVKSRIGIDQDAYSLTDRDNIFEF
KITH_BLOPB      MAQLYFYYSAMNAGKTTALLQSSYNYQERGMRTVLYTADMNSRDNKQIKSRIGLYASARVFNIKTNFFDQ
KITH_STRP3      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVSSRIGMRREAIPISNDMDIFTF
KITH_STRPM      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVSSRIGMRREAIPISNDMDIFTF
KITH_STRP8      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVSSRIGMRREAIPISNDMDIFTF
KITH_STRP6      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVSSRIGMRREAIPISNDIDIFTF
KITH_STRP1      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGVSSRIGMRREAIPISNDMDIFTF
KITH_STRMU      LAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRDGFGVASRIGMRREAVTITDDMDIFAY
KITH_STRGC      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKGVVIMTSAVDTRDGVGVSSRIGMKRQAMAIEDDTDILGY
KITH_LACSS      MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKSVIILTSGIDNRDGVGVSSRIGLKREATPIFSDTNIY--
KITH_STRT2      MAQLYFRYGTMNSGKSIEILKVAYNYEEQGKPVVLLTSRLDDRDEVGISSRIGMRRKAYPIGNDTDIFDY
KITH_STRT1      MAQLYFRYGTMNSGKSIEILKVAYNYEEQGKPVVLLTSRLDDRDEVGISSRIGMRRKAYPIGNDTDIFDY
KITH_BLOFL      MSKLYFYYSAMNAGKTTALLQSSYNYQERGMRTLLYTAAVVCQKNDYIRSRIGLTSSARIFNGKTNLFKQ
KITH_STRR6      MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGVSSRIGMKRPALAIEETTDIFGY
KITH_STRPN      MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGVSSRIGMKRPALAIEETTDIFGY
KITH_STRA5      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVSSRIGMRREAVPISDDMDIFSY
KITH_STRA3      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVSSRIGMRREAVPISDDMDIFSY
KITH_STRA1      MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVSSRIGMRREAVPISDDMDIFSY
KITH_LISMF      MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGISSRIGLKREATPIFSDTNIFEI
KITH_LISMO      MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGISSRIGLKREATPIFSDTNIFEI
KITH_LISIN      MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGISSRIGLKREATPIFSDTNIFEI
KITH_LACLA      MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGGTVASRIGMKAEAVAIDEEMSVFDY
KITH_CHRVO      MAKLFFRYAAMNSGKSTQLLQIANNYESMDKKVALYTSAIDDRYGVGITSRLNIQRESNTFDAGFDFLAH
KITH_LACPL      MAQLFFRYGAMNSGKTIEILKVAHNYEEQDKSVIILTSGLDNRDGVGVASRIGLKREATPVFDDTNIF--
KITH_BACSK      MAQLFFKYGAMNSGKSIEILKVANNYEEQKKPVLIFTSGMDTRDEVGVSSRVGLRRRAVPIFDDTNIFDY
KITH_RHOFD      MSQLTFIFAAMNAGKSTLLLQAAHNYVERGMAVELYTAALDTRAGLGVRSRLGIERGASTFNADT---VF
KITH_LACJO      MAQLFFRYGAMSSGKSIEILKVAHNYEAQGRKIALMTSNVDDRSGGTVASRIGLHRKAVPISEDLDLFNY
KITH_LACAC      MAQLFFRYGAMSSGKTIEILKVAHNYEAQGRKIALMTSGLDNRSGGTVASRIGIHRKAIPITEEMDLFEY
KITH_ENTFA      MAQLFFKYGAMNSGKTIEILKVAHNYEEQDKPVVLMTSGLDTRDGGKVSSRIGLRRDAIPIFEETNVFDL
KITH_ENCCU      ---LNFVTSPMNAGKTANMLLRARHAATLGRRVLLAKPLSDTRHESSVRSRCGIEMKCDLCAGPEF--SF
KITH_PROAC      MAELVFHTGPMDSGKSTLALQMDHAQSAHDRQG-VRYAMHDRSGGARITSRIGLSVEAVEVTDSDLYQDI
KITH_STRAW      MPELVFFSGTMDCGKSTLALQIGHNRSARGLQGVIFTR--DDRAGEGLSSRLGLVTEAVEAAPGMDLHAY
KITH_STRCO      MPELVFFSGTMDCGKSTLALQIEHNRSARGLAGMIFTR--DDRAGEGLSSRLGLVTDAVEVGDGQDLYAH
KITH_PYRAE      ----------MFAGKTTELIRRVERYVIAGRRAIVFKPSLDVRDASKVAAHNGLKFDAFVIPPDKDGVEI
KITH_THELT      --KLTLIVGPMYSGKTTELLSYVEIYRLGRKKTIVFKPSLDNRYGDCVKTHAGVEVEAIAVEKSADAMKY
KITH_THEP1      --KLTIITGPMYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRHSTMIVSHSGNGVEAHVIERPEEIRKY
KITH_PYRKO      ----------MFAGKTTELIKRVERQIFAKRKAALFKPAIDNRYSERVVAHNGLRYEAFVVPTTEKGVER
KITH_THESQ      ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRHSTMIVSHSGNGVEAHVIERPEEMRKY
KITH_THEMA      ----------MYSGKTTELLSFVEIYKLGKKKVAVFKPKIDSRHSTMIVSHSGNGVEAHVIERPEEMRKY
KITH_AMEPV      ----------MFSGKTTELMRKINRYILSNQKCVIITHNIDNRFNKNIINHDGILNKEYLYIKTNNL---
KITH_UREU1      ----------MFAGKTAELIRRLHRLEYADVKYLVFKPRIDTRSTQNIKSRTGTSLPSIEVENAPEILSY
KITH_STAAW      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAAS      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAAR      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAAC      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAAB      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAA3      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_MYCPN      ----------MFSGKTEELLRKIKRWKLAKIPVIIFKPKIDTRQQHLVKSRNGHSDEAIEINSPLEIYDY
KITH_UREPA      ----------MFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNY
KITH_UREP2      ----------MFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSRTGTSLPSVEVESAPEILNY
KITH_STAAN      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_STAAM      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNAIEAINISKASEIMTH
KITH_THEPX      ----------MFSGKSEELIRRIKRAQIAKQKVQVFKPAIDDRYSDKVVSHNGTNINAISV-----VKAF
KITH_THEP3      ----------MFSGKSEELIRRIKRAQIAKQKVQVFKPAIDDRYSDKVVSHNGTNINAISV-----VKAF
KITH_MYCCT      ----------MFAGKTEEFIRRLKVLSYAKKRVLAFKPSIDNRYSENIISHSGSKLDSYLVKSSDEIKQI
KITH_BACLD      ---------SMFSGKSEELIRRIKRATFAKQEVKVFKPAIDNRSSESVVSHNGTSIVCHAIASPEEIFQY
KITH_FOWPV      ---IHVITGPMFSGKTSELVRRIKRFMLSNFKCIIIKHCGDNRYNEDDINKVYTHDLLFMATASSNLSVL
KITH_BACA2      ---------SMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEVVSHNGTSMTSHVISSSAEIWDH
KITH_CLOTE      ----------MYSGKSEELIRRVRRVKIAKQKVQVFKPEIDNRSNEDVVSHCGDKEGAVPIKSSEDIL--
KITH_CFEPV      ----------MYSGKTTELIRRITRYKLCKKNCVIISHSIDNRHDDD---NILINHDGFKISHDDXXXXX
KITH_ONYPE      ----------MFAGKTEALIQRSNQALQLNKKILSFKPQIDDRYSEEIVSHNQNTIPAILIDKSKDILPF
KITH_STAHJ      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHDGNELEAINISTSRDI---
KITH_STAES      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNEIEAINISTAQEILNH
KITH_STAEQ      ---------SMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRHKEKVVSHNGNEIEAINISTAQEILNH
KITH_MYCA5      ----------MFSGKSEELLKRIRTLEYAKLKPLVIKPEFDTRFSENIVSRAGVKHKTHILKNINDVYF-
KITH_THETN      ----------MFSGKSEELXXXXXXXXXXXXXVQVFKPAIDDRYSDKVVSHNGSSINAISVTKASEILDL
KITH_CBEPV      ----------MYSGKTTELIRRITRYKLCKKNCVIISHSIDNREDDNIL----INHDGFKISHDDXXXXX
KITH_STAS1      ---------SMFSGKSEELIRRLRRGLYAKQKVVVFKPAIDDRHNGNAIEAINISTAAEILKHD------
KITH_CLOAB      ----------MYSGKSEELXXXXXXXXXXXXXXXVFKPEIDNRSKEDVVSHMGEKEQAVAIKNSREILKY
KITH_ANOFW      ---------SMFSGKSEELIRRVRRAQFAKQEVKVFKPAIDNRYSEEVVSHNGTSVIAIPVSCASDIRKH
KITH_MYCMO      ----------MYSGKSEELIKRIKILQFANIKTLIVKQKFDTRFSHNIVSRSGTKLNTIVASNVEEIKKV
KITH_CLOBJ      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_CLOB6      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_BACHD      ---------SMFSGKSEELIRRVRRATYGRLKVQVFKPAIDNR----YSEQEVVSHNGNKVCAIPVERAM
KITH_OCEIH      ---------SMFSGKSEELIRRVRRATYAHINVRVYKPAIDDRDDKAIVSHDGTSTMARPIHDAVEILED
KITH_CLOBM      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVRSS---KEI
KITH_DEIRA      ----------MFSGKSEELIRRLTRSLIARQRVAVFKPAIDNRHASEVASHAGRTLEAVAVPDAQAIRAQ
KITH_BACC4      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_ORYSJ      --EIHVIVGPMFAGKTTALLQVEAGTGSRNVA--LIKSDKDNRYGDSVVTHDGTKMPCWALPE---LSSF
KITH_GEOSW      ---------SMFSGKSEELIRRVRRATFAKQEVKVFKPTIDNRYSDEVVSHNGNSLIAIPVSSP---KEI
KITH_CLOBL      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_CLOBK      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_CLOBH      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_CLOB1      ----------MYSGKTXXXXXXXXXXXXXKQKVQVFKPEIDNRSKQDVVSHAGDKIQSVPVKSS---KEI
KITH_BACCZ      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSSKDIFKHI
KITH_BACCR      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACC2      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACAN      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSSKDIFKHI
KITH_BACAC      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSSKDIFKHI
KITH_BACAA      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSSKDIFKHI
KITH_BACHK      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACCQ      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACC7      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACC3      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACC1      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACC0      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACAH      ---------SMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSAS---KDI
KITH_BACSU      ---------SMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAVVSHNGTSMTSYAISSAADIWDH
KITH_BACCN      ---------SMFSGKSEELIRRVRRTQFAKQNAIVFKPCIDNRSEEDVVSHNGMKVKAVPVSASKDIFKY
KITH_COPPD      ----------MFSGKTEELVRRLRRAVIAKKETIAIKPALDTRDLVAVVSHSGFSFNAIPVEDPKSILGM
KITH_MYCGA      ----------MFAGKTDELIRKIKRYEYADVKSLVFSPATDTRSAQEIIN----SRDGRRIGSIKIKKAF
KITH_BACWK      ---------SMFSGKSEELIRRIRRTQFAKQHAIVFKPCIDNRSEEDVVSHNGLKVKAVPVSASKDIFNH
KITH_AYWBP      ----------MFAGKTESLIQRRNKALKLKKKILSFKPRIDDRYSEEIVSHNRNNIPAILIDKSKDILTF
KITH_GEOTN      ---------SMFSGKSEELIRRIRRAQFAKQEVKVFKPTIDNRSEDAVVSHNGNSVIAIPVATPAELFRY
KITH_MYCHJ      ----------MFSGKSDELIKRIKILTYADIKTLVIKPSVDYRFSQEIVSRSGLKIPTFLARTTQEIR--
KITH_MYCH7      ----------MFSGKSDELIKRIKILTYADIKTLVIKPSVDYRFSQEIVSRSGLKIPTFLARTTQEIR--
KITH_MYCH2      ----------MFSGKSDELIKRIKILTYADIKTLVIKPSVDYRFSQEIVSRSGLKIPTFLARTTQEIR--
KITH_MYCGE      ----------MFSGKTEKLLHKIKRWKIAKISVVIFKPIIDTRQTNIVKSRNGEYDQAITINSPFEI---
KITH_DICDI      --KIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNI-------DKSFLVTHDQNYQAF
KITH_MYXVL      --QIHLIIGPMFAGKSTELIRLVKRYQIARYKCLVVKYEKDARYGNGVRTHDNTCISAVPTASLDDVESI
KITH_GEOKA      ----------MFSGKSEELIRRVRRAQFAKQEVKVFKPTIDNRSEDAVVSHNGNSVIAIPVATPAEMFRY
KITH_BACNA      -----FNTGLMGSGKSKKLID---DYLIDPKEKVALSVSLDTFSRGKIESRDGRSLRSINLNRDQFKQSL
KITH_MYCPE      -------YGPMFAGKSXXXXXXXXXXDYADVIYQVFKPKIDTRTKNKIMSRDGRNMDSF---EFDNPYEI
KITH_ROSS1      ----------MFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRYRGSLVSHNGLSVEARVIDSIRDIPAY
KITH_MACCJ      ---------SMFSGKSEELIRRVRRGLFAKQKVIVFKPSIDDRYSEEVVSHNGNKVEAVNVHHSSEILEH
KITH_MYXVU      --QIHLIIGPMFAGKSTELIRLVKRYQIARYKCLVVNYEKDARYGNGVRTHDNTCISAVPTASLDDVESI
KITH_RFVKA      ---IHLIIGPMFAGKSTELIRLVRRYQIAKHKCLVVKYEKDIRYGNGVCTHDNMSITAVCTPSLDKIDSV
KITH_MOUSE      ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSNSFST--------HDRNTMDALPAC
KITH_DEIDV      ----------MFSGKSEELIRRVTRALIARQRVQVFKPAVDDRYHESVASHAGRTVGALAVGDVADIRAH
KITH_BACP2      ---------SMFSGKSEELIRRAKRATFAKQEVKIFKPAIDNRXXXXXXXXXXXXDGIAVASPKDIITHI
KITH_MYCMS      ----------MFAGKTEEFIRRLRVLSYAKKRVLAFKPSIDNRYSENIISHSGSKLDSYLVHSSDXXXXX
KITH_CRIGR      ----------MFSGKSTELMRRVRRFQIAQNKCLVIKYAKDTRYSSSFST--------HDRNTMDALPAC
KITH_CHLAD      ----------MYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRYAEHVASHSGSRLEAITVA------TM
KITH_ROSCS      ----------MFSGKTEELIRRLNHVRLARQRLIAFTPRRDTRYRGSLVSHNGLSVEARVIDSIRDTPAH
KITH_BDEBA      ---------SMFSGKTEELIRRLRRAEFARLQIQVFKPIIDKRYNE-------MAVTSHDLTTIDSTPIH
KITH_HUMAN      ----------MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCT--------HDRNTMEALPAC
KITH_MIMIV      ----------MFSGKTTEFIRLIERKKIAGKKCLIIKNYRDIRYDSDDNDKYHVTTHNNIIYRNCDIM-F
KITH_CHLSY      ----------MYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRYAEGVASHSGSRLEAITVATMKDILAH
KITH_CHLAA      ----------MYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRYAEGVASHSGSRLEAITVATMKDILAH
KITH_CHICK      -------FGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTR-----YCTTGVSTHDRNTMEARPACAL
KITH_MONPV      ----------MLSGKSTELIRRVRRYQIAQYKCVTIKYSNDNRYGTGLWTHDKNNFAALEVTK------L
KITH_BOVIN      ----------MFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTRYSSLFST--------HDRNTMEALPAC
DNAA_MYCMS      -----FIYGESGMGK-THLLKAAKNYIESNFSDL----KVSYMSGDEFARKVDILQKTH-----KEIEQF


                         .         .         *         .         .         .         .:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
KITH_IDILO      VRARYMQQAIDCVLIDEAQFLSEEQVWQLSSLADTDNIPVMCYGIRTDAFGNAFPGSAVLLAIADKLVEM
KITH_MANSM      IKRHLASEKLHCILIDEAQFLTKQQVYQLSDVVDLLNIPVLCYGLRTDFQAELFEGSQYLLAWADQLEEL
KITH_VIBF1      IKELHEAEKLHCVLIDECQFLTKEQVYQLTEVVDKLNIPALCYGLRTDFLGELFEGSKYLLSWADKLVEL
KITH_VIBPA      IAALHEVEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLSWADKLVEL
KITH_VIBCH      IATLHEAEPRHCILMDECQFLSKEQVYQLTEVVDKLDIPVLCYGLRTDFLGELFEGSKYLLSWADKLIEL
KITH_PHOPR      LSMMHADTHIDCVLIDECQFLTKEQVYQLTEVVDKLHIPVLCYGLRSDFRGELFDGSRYLLSWADKLVEL
KITH_HAEDU      VEQVLKAKKLHCIMIDEAQFLTKKQVHQLTDVVDELKIPVLCYGLRTDFQKELFEGSQYLLAWADELQEL
KITH_VIBVU      IAALNEVEKRHCILVDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLSWADKLVEL
KITH_LEGPL      TQELLQATKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIEL
KITH_VIBVY      IAALNEVEKRHCILVDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDFLGELFEGSKYLLSWADKLVEL
KITH_LEGPA      TQEFLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIEL
KITH_LEGPH      TQEFLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIEL
KITH_HAEIN      INEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEEL
KITH_HAEI8      INEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEEL
KITH_RHOBA      VRNETRINPLHCVLVDEAQFLTRTQVRQLSDVCDDLDIPVLAYGLRTDFQGNLFEGSEHLLAWADTLTEL
KITH_PASMU      IAQHLQQQPLHCILVDEAQFLTKTQVYQLSEVVDKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEEL
KITH_PSEHT      IQSLNQDKKRHCVLVDECQFLSKEQVMQLTDVVDELGIPVLCYGLRNDFRGELFTGSQYLLAWADKLVEL
KITH_SHIDS      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_JANSC      IDARLKAGPCACVLVDEAQWMTRDQVWQLARAVDDLGVPVMCYGLRVDFRGELFPGSAALLALADEMREV
KITH_COXBU      SDKLAENPNIRCVLVDEAQFLTKSQVEALALVTDELNLPVLAYGIRTDFQGEPFEGSVYLLAWADLLIEI
KITH_YERPS      IAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDFLGELFPGSKYLLAWADKLVEL
KITH_YERPE      IAAEHQDTPIHCILLDECQFLTKEQVQELCQVVDELHLPVLCYGLRTDFLGELFPGSKYLLAWADKLVEL
KITH_SHISS      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_SHIFL      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_SHIBS      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_ERWCT      LEKEHRTQPVDCVLIDECQFLTREQVNELSDVVDQLDIPVLCYGLRTDFRGDLFSGSHYLLAWADKLIEL
KITH_ECOLI      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_ECOL6      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_ECO57      IRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDFRGELFIGSQYLLAWSDKLVEL
KITH_SALTY      IRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVEL
KITH_SALTI      IRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVEL
KITH_SALPA      IRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVEL
KITH_SALCH      IRAESVRQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDFRGELFVGSQYLLAWSDKLVEL
KITH_XANAC      VERDIHNDGLHCVLVDEAQFLSRAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_BPT4       YKWAEAQKDIHCVFVDEAQFLKTEQVHQLSRIVDTYNVPVMAYGLRTDFAGKLFEGSKELLAIADKLIEL
KITH_XANC5      VERDIHNDGLHCVLVDEAQFLGRAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_AGRT5      VAALHAQAPVACVFVDEANFLSEHHVWQLANIADRLNIPVMTYGLRTDFQGKLFPASKELLAIADELREI
KITH_SILPO      IRDRLGAGPVACVFVDEAQFLSPEQVWQLARVVDDLDVPVLAYGLRVDFQGKLFPGSATLLALADEMREV
KITH_XANOR      VERDIHNDGLHCVLVDEAQFLSRAQVWQLSEVVDRLRVPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_XANOM      VERDIHNDGLHCVLVDEAQFLSRAQVWQLSEVVDRLRVPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_SHEON      ITAAHQENHLSCVLVDECQFLSKEQVKQLTYIVDKIDIPVLCYGLRTDFQGELFSGSHYLLAWADKLVEL
KITH_PHOLL      IRNENKQAKVHCVLIDECHFLTKAQIEQICKVTDYDDIPVLCYGLRTDFRGELFSGSQYLLAWADKLVEL
KITH_RHIME      IERL-NGDGIACVFVDEAQFLGEDQVWQLARVADRLGIPVMAYGLRTDFQGKLFPGSMALLAIADELREV
KITH_NOVAD      ISAAHAVQPLSCVLVDEAQFLRRDQVWQLARVADAAGIPVLCYGLRTDFQGELFEGSAALLGIADSLIEL
KITH_RHIEC      VMTLSEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTDFQGKLFPASQELLAIADEMREV
KITH_COLP3      VDQKHQAEKIDCVLIDEAQFLSTEQVKQLTDIVDLLHIPVLAYGIRTDFLGQTFSGSAALLAWADKLVEL
KITH_XANCP      IERDIAAHGLHCVLVDEAQFLSSAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_XANC8      IERDIAAHGLHCVLVDEAQFLSSAQVWQLSEVVDRLRIPVLCYGLRTDFRGELFEGSQFLLAWADELEEI
KITH_ZYMMO      IQEQHVKNPLHCILIDEAQFLNKNQVFELARVCDDLNIPVLCYGLRTDFQAELFEGSKYLLAIADKLAEI
KITH_RHILO      VAEHHDHTTVHCVFVDEAQFLEEEQVWQLARIADRLNIPVMCYGLRTDFQGKLFSGSRALLAIADDLREV
KITH_FRATT      VENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIVDELNIPVICYGLRTNYLGQPFXXXXXXXXXXXXXXXV
KITH_FRATH      VENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIVDELNIPVICYGLRTNYLGQPFXXXXXXXXXXXXXXXV
KITH_BLOPB      VVTIHQKDIIHCVLVDECHFLNRNQVIDLSKIVDVLNIPVLCYGLRTDFRADLFSGSLWLLAWADKLIEL
KITH_STRP3      IAQLEEKPY--CVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRPM      IAQLEEKPY--CVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRP8      IAQLEEKPY--CVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRP6      IAQLEEKPY--CVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRP1      IAQLEEKPY--CVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRMU      IENMFKKPY--CILIDESQFLSQKNVYDLARIVDELDVPVMAFGLKNDFQNHLFEGSRELLLLADKIEEI
KITH_STRGC      IKNLPEKPY--CILIDEAQFLKRHHVYDLARVVDELDVPVMAFGLKNDFRNELFEGSKHLLLLADKIEEI
KITH_LACSS      --ELVEATNPDCVLIDESQFLERHHVIEAAKVVDDLNIPVMAFGLKNDFKNELFEGSKYLLLFANKIEEM
KITH_STRT2      IDDISPRPY--CVLIDEAQFLTRANVYDLARIVDELDIPVMAFGLKNDFQNNLFEGSKYLLLLSDKIEEI
KITH_STRT1      IDDISPRPY--CVLIDEAQFLTRANVYDLARIVDELDIPVMAFGLKNDFQNNLFEGSKYLLLLSDKIEEI
KITH_BLOFL      ISIVNKEKKIHCILIDECHFLNRNQVIDLTKVVDILNIPVLCYGLRTDFQSKLFSGSLWLLAWADKLIEL
KITH_STRR6      IRDLPEKPY--CVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRNELFEGSKYLLLLADKIDEI
KITH_STRPN      IRDLPEKPY--CVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRNELFEGSKYLLLLADKIDEI
KITH_STRA5      IQNLPQKPY--CVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRA3      IQNLPQKPY--CVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_STRA1      IQNLPQKPY--CVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQNNLFEGSKHLLLLADKIDEI
KITH_LISMF      VANIKPKP--NCVLLDESQFLEKEHVFQLAKIVDELNIPVIAYGLKNDFRNELFEGSKYLLLYADKLEEM
KITH_LISMO      VVNIKPKP--NCVLLDESQFLEKEHVFQLAKIVDELNIPVIAYGLKNDFRNELFEGSKYLLLYADKLEEM
KITH_LISIN      VANIKPKP--NCVLLDESQFLEKEHVFQLAKIVDDLNIPVIAYGLKNDFRNELFEGSKYLLLYADKLEEM
KITH_LACLA      VNSLPAKPF--CVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRNELFEGSKYLLLLADKIEEI
KITH_CHRVO      -----DYGDTACVLVDEAQFMTPEQAQQLHRLAHKRNIPVICFGLRTDFQGHPFPGSAWLLSLADDVEEI
KITH_LACPL      --EIVKQTNPDCVLIDEAQFLKKHHVLELADIVDELKIPVMTFGLKNDFRNELFEGSKYLLLYADKIEEM
KITH_BACSK      VESCRQKPY--CVLIDEVQFLTKAHVLQLANIVDTLDIPVMGFGLKNDFRNELFEGSKYMLLYADKIEEM
KITH_RHOFD      DHRILERDTA-CLLIDESQFLRPVQVRQLHRLAHTSQVPIRCYGLRSDFLGHPFAGSAALLTLADEFEEV
KITH_LACJO      VSELNKSDRVACVLIDEAQFLKRHHVLECAKIVDELKIPVMAFGLKNDFQNHLFEGSENLLIFADKVEEM
KITH_LACAC      IKEMNNHDLADCVLIDEAQFLKRHHVLECAKIVDEFNIPVMTFGLKNDFQNHLFEGSENLLIFADKIEEM
KITH_ENTFA      INDLSYKPF--CVLVDECQFLNKHHVIEFARIVDELDIPVMAFGLKNDFRNELFEGSKYLLLYADKLEEL
KITH_ENCCU      TKDVLYGD-VDILLVDEAQFLSSRQIDELREVADVHGIPVWCYGLLTDFKKNLFEGSKRLVELCDKMIEL
KITH_PROAC      VSRLSRGGRIDYLICDEAQFYRTKQIDQLARVVDDLDIDVYCFGILADFRTELFPGSKRLVELADRVVEP
KITH_STRAW      LVDQMSKGGVDYLIVDEAQFLAPEQIDQLARXXXXXXXXXFAFGITTDFRTKLFPGSQRLIELADRTLQV
KITH_STRCO      VVDHLSQGGVDYVIADEAQFLAPDQIDQLARXXXXXXXXXYAFGITTDFRSKLFPGSQRLVELADRVLQV
KITH_PYRAE      IRKMGA--EYDVVAVDEIQFFPVDLADALNQLAN--GRIVIAAGLNLDFRGEPFETTARAMAFADRVISL
KITH_THELT      IKQ-----PVDAVFVDEVQFFDKDLVKIVRQLLDQ-DVDIFCAGLDMTFKQNPFETTMLLMSLANEIIKK
KITH_THEP1      IE-----EDTRGVFIDEVQFFSPGLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
KITH_PYRKO      IKEITLNEGYEVIGIDEVQFFPMSVVEALNELADQ-GIYVIASGLNLDFKGDPFPVTKELLVRADNIVYL
KITH_THESQ      IE-----EDTRGVFIDEVQFFSPGLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
KITH_THEMA      IE-----EDTRGVFIDEVQFFNPSLFEVVKDLLDR-GIDVFCAGLDLTHKQNPFETTALLLSLADTVIKK
KITH_AMEPV      INEINIVDNYDIIGIDECQFFEENDLEQFCDKMANNKKKVIVAGLNCDFNRNIFNSISKLIPKVEKIKKL
KITH_UREU1      IMSDNFDNEIKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFAYADKITKL
KITH_STAAW      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAAS      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAAR      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAAC      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAAB      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAA3      -----DLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_MYCPN      LTK----DRFDVVAIDEAQFFSSEIVEVVKSLND-LGINVIVSGLDTDFRAEPFGSIPQLLAIADKICKL
KITH_UREPA      IMSNSFNDETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
KITH_UREP2      IMSNSFNDETKVIGIDEVQFFD-DRICEVANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKL
KITH_STAAN      -----NLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_STAAM      -----NLTNVDVIGIDEVQFFD-DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKL
KITH_THEPX      --EIIELEDTEVIAIDEIQFFIVDVVREIAD----LGKRVICAGLDMDFRGEPFGPTPDVMAIAESVDKL
KITH_THEP3      --EIIELEDTEVIAIDEIQFFIVDVVREIAD----LGKRVICAGLDMDFRGEPFGPTPDVMAIAESVDKL
KITH_MYCCT      VEKENQIQQVDVIGIDEVQFFVVDIIEQLAD----NGIIVIVNGLDKDFRGLPFKNVDKLLVKAEFVTKL
KITH_BACLD      ISKETDVIG-----VDEVQFFDETIVGTLTSLADQ-GYRVIAAGLDLDFRGEPFGVVPDLMALAETVTKL
KITH_FOWPV      VPTLLN-DGVQVIGIDEAQFFL--DIVEFSESMANLGKTVIVAALNGDFKRELFGNVYKLLSLAETVSSL
KITH_BACA2      IS-----ESTDVIAVDEVQFFGESIIGDLSSLADK-GYRVIAAGLDMDFRGEPFGVVPNLMAVAESVTKL
KITH_CLOTE      --KLIKED-TEVVAIDEAQFFDKGILEVVNKIANE-GKRVICAGLDQDFKGEPFGYMPDIIAVAEFVHKV
KITH_CFEPV      XXXXXXFDKYEIIGIDECQFFDSNDLIIFCDTLANNGKKIIVAGLNSDFNKNPFKSIIKLIPISEKITKL
KITH_ONYPE      I-----TPEINVVIIDEAQFLDNDIV----AIVDYLNIEVIISGLELDFCGKPFGPMPYLLAIADTVTKL
KITH_STAHJ      --LLQDLSHVDVIGIDEIQFFDKEIVNIVEKLAEN-GHRVVVAGLDMDFRGEPFEPMPQIMAVSEQVTKL
KITH_STAES      -----KLEEVNVIGIDEVQFFEDDIVNIVEKLAEN-GHRVIVAGLDMDFRGEPFKPMPKLLAVSEHITKL
KITH_STAEQ      -----KLEEVNVIGIDEVQFFEDDIVNIVEKLAEN-GHRVIVAGLDMDFRGEPFKPMPKLLAVSEHITKL
KITH_MYCA5      ---LLQEDKYKAVVIDEAHWFNEELVKVADDLANK-GYLVIVAGLDQNYLREPFGPIPNLLAIAERVTKL
KITH_THETN      LEEDTQV-----VAIDEIQFFDHSLVDVVREIAD-MGKRVICAGLDMDFRGEPFGVTPDIMAIAESVDKL
KITH_CBEPV      XXXXXXFDKYEIIGIDECQFFDSNDLMIFCDTLANNGKKIIVAGLNSDFNKNPFKSIIKLIPISEKITKL
KITH_STAS1      ------LSEVDVIGIDEVQFFENGIVH-IAEQLAEKGHRVITAGLDMDFRAQPFEPMPQLMAVSEDVTKL
KITH_CLOAB      FEEDTEV-----IAIDEVQFFD-DEIVEIVNKIAESGRRVICAGLDMDFRGKPFGPIPELMAIAEFVDKI
KITH_ANOFW      I-----TTHTDVVAIDEVQFFVVDVVQQLADE----GYRVIVAGLDQDFRGEPFGPVPTLMSIAESVTKL
KITH_MYCMO      WNNTYK-----AIAIDEVQFFDKDIINYIDELASK-GIRVIISGLDTDFARKPFGIMPELLAIADDVLKL
KITH_CLOBJ      LEKL--LDDTDVIGIDEAQFFD-DSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_CLOB6      LEKL--LDDTDVIGIDEAQFFD-DSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_BACHD      SILEQWSEDTDIVAIDEVQFFDEDVI----GVVDYLGVRVICAGLDQDFRGEPFEPTRTLMAMAEYVTKL
KITH_OCEIH      VDNNVEIVGI-----DEVQFFVVDVIEELAD----RGIRVIVAGLDLDFRGEPFEPVPKIMALAESVTKL
KITH_CLOBM      LEKL--LDDTDVIGIDEAQFFD-DSLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_DEIRA      LSGQGELEGVDVIGIDEAQFFGPELVPLVLELAD-AGVRVVLAGLDLDFRAEPFGSMPELLARAESVDKL
KITH_BACC4      FEHITE--ELDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_ORYSJ      QDKLEAYDKVDVIGIDEAQFF--DDLHDFCKAADRDGKIVVVAGLDGDYKRNKFGSVLDIIPLADSVTKL
KITH_GEOSW      FEHISE--KTDVIAIDEVQFFSDDIIDVVQTLADR-GYRVIVAGLDQDFRGEPFGPVPTLMAIAESVTKL
KITH_CLOBL      LEKL--LDDTDVIGIDEAQFFD-DFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_CLOBK      LEKL--LDDTDVIGIDEAQFFD-DFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_CLOBH      LEKL--LDDTDVIGIDEAQFFD-DFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_CLOB1      LEKL--LDDTDVIGIDEAQFFD-DFLVEIVSKIANNNRRVICAGLDMDFKGEPFGPMPKLMAIAEFVDKI
KITH_BACCZ      TEEM------DVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACCR      FEHITE--ELDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACC2      FEHITE--DMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACAN      TEEM------DVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACAC      TEEM------DVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACAA      TEEM------DVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACHK      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACCQ      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACC7      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACC3      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACC1      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACC0      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACAH      FEHITE--EMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_BACSU      IS-----ESTDVVAVDEVQFFDQEIVEVLSSLADK-GYRVIAAGLDMDFRGEPFGVVPNIMAIAESVTKL
KITH_BACCN      V-----TEDMNVIAIDEVQFFDEDIV-EVVQILANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEYVTKL
KITH_COPPD      AK------DAEVVGIDEAQFFTGELVPVIRELLQN-KKRVIVAGLDLDFRGEPFGIMPTLLALADEVTKL
KITH_MYCGA      -------EIYDYVLLHKPQLVGIDEVQFFDDIVEVIQINVIVAGLDRDFRGEPFGPIPKILGIAESVIRL
KITH_BACWK      V-----TEEMDVIAIDEVQFFD-------GDIVEVVQVRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKL
KITH_AYWBP      I-----TPEINVVIIDESQFLDNDII----AIVDYLNIEVIISGLELDFCGKPFGPMPYLLAIADTVTKL
KITH_GEOTN      ISAT-----TDVVAIDEVQFFSDDIIDVVQTLADR-GYRVIAAGLDQDFRGEPFGPVPALMALAESVTKL
KITH_MYCHJ      --DLFTRDNYQAIAIDEIQFFDEEIVTFLEQIADK-GIRVIVSGLDQDFRRKPFGSLPNLMAIAENVTKL
KITH_MYCH7      --DLFTRDNYQAIAIDEIQFFDEEIVTFLEQIADK-GIRVIVSGLDQDFRRKPFGSLPNLMAIAENVTKL
KITH_MYCH2      --DLFTRDNYQAIAIDEIQFFDEEIVTFLEQIADK-GIRVIVSGLDQDFRRKPFGSLPNLMAIAENVTKL
KITH_MYCGE      YDHLVD-KNYQIVAIDEAQFFS-NEIIEVVTTLNEIGTNVIISGLDTDFRAEPFGCIPQLLAIADVVNKL
KITH_DICDI      PCSILEAQNYDVIGIDEGQFF--PDVVQFSEDLANQGKTVIIAALDGTFQRKPFQSVIDLVSKAEYITKL
KITH_MYXVL      SEH------VEVIGIDEGQFF--PNIVSFCERMANAGKVLIVAALDGTFQRKPFTNICELIPLAENVTKL
KITH_GEOKA      ISA-----ATDVVAIDEIQFFSDDIIDVVQTLAD-CGYRVIAAGLDQDFRGEPFGPVPALMAIAESVTKL
KITH_BACNA      LEIIIFMTNTQTIYIDESQFLPKETVEKFVSLSESYHVPIHFYGLDLTFTGELFDSSSHLLTILPSENIN
KITH_MYCPE      FDKLLSLENPHVVAIDEAQFAIVDVCQALAD-SGYI---VYVSALDKNFKNEPFMVTAKIACIAEYVEKL
KITH_ROSS1      LDSDVDVVAVDELLLDDPPDAAREVCQQLADR----GLRVIVAGLDQDFRAQPFPAMAQLMAVAEQVDKL
KITH_MACCJ      VK-----EAHDIIAIDEVQFFDNDIVGVATQLAEE-GYRVIVAGLDMDFRGVPFEPVPELMAVSEHVTKL
KITH_MYXVU      SEH------VEVIGIDEGQFF--PNIVSFCERMANAGKVLIVAALDGTFQRKPFTNICELIPLAENVTKL
KITH_RFVKA      AENA------EVIGIDEGQFFPCERMANRGKVL-------IVAALDGTFQRKPFSNISELIPLAENVTKL
KITH_MOUSE      MLRDVESLGVAVIGIDEGQFFP--------DIVDFCEMTVIVAALDGTFQRKAFGSILNLVPLAESVVKL
KITH_DEIDV      LSGEAPLEMPDVIGIDEVQFFGPELVPLALELAD-AGVRVILAGLDLDFRAEPFGCMPDLLARAESVEKL
KITH_BACP2      SER------TDVIGIDEVQFFIIDIVTQLADK----GYRVIVAGLDQDFRGEPFGVVPHLMACAELVTKL
KITH_MYCMS      XXXXXXXXXVDVIGIDEVQFFD-EQVVELIEQLANQGIIVIVNGLDKDFRCLPFKNVDKLLVTAEFVTKL
KITH_CRIGR      LLRDVEALGAAVIGIDEGQFF--PDIVEFCEVMANAGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKL
KITH_CHLAD      CEILAYARDVQVVAIDELHLFDDDPAEMVRQVLADRGARVIVAGLDLNYRAEPFPAMMHLLALAEQVDKL
KITH_ROSCS      LNTDIHVVAVDELLLDDPPDAAREVCQDLADR----GLRVIVAGLDQDFRAQPFPAMAQLMAVAEQVDKL
KITH_BDEBA      AEEIWNLPNTKVVGIDEGQFFGQNLVQIAQDLADR-GLRVIIAGLDTDWQGKPFEPMPTLMAVAESVTKQ
KITH_HUMAN      LLRDVEALGVAVIGIDEGQFF--PDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL
KITH_MIMIV      TDNLNKTSLIDTFQ-EKYDVIGIEEGFFFEGVTDFSNMEVIISTLESSYKQEIFSEIGKLIAISEDVIKL
KITH_CHLSY      AE--------------DAQVVAIDELHLFDDDPAEMGVRVIVAGLDLNYRAEPFPAMMHLLALAEQVDKL
KITH_CHLAA      AE--------------DAQVVAIDELHLFDDDPAEMGVRVIVAGLDLNYRAEPFPAMMHLLALAEQVDKL
KITH_CHICK      QDVYQEALGSAVIGIDEGQFF--PDIVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKL
KITH_MONPV      CDVLEAITDFSVIGIDEGQFFP--------DIVEFCERMVIVAALDGTFQRRPFNNILNLIPLSEMVVKL
KITH_BOVIN      LLRDVIQDAVAVIGIDEGQFFP--------DIVEFCGKTVIVAALDGTFQRKAFGTILNLVPLAESVVKL
DNAA_MYCMS      KNKICQ---NDVLIIDDVQFLS------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK
KITH_IDILO      KTICHCGRKATMSLRVDEQGNAIMGQQIAIGGNDRYVSCCRKHWKE-----
KITH_MANSM      KTICHCGRKANFVLRLNERGDVVKGEQIQIGGNERYLSVCRFHFKQ-----
KITH_VIBF1      KTICHCGRKANMVIRTDEHGVAIAGDQVAIGGNELYVSVCRRHYKE-----
KITH_VIBPA      KTICHCGRKANMVIRTDEHGVAIEGDQVAIGGNDRYVSVCRQHYKE-----
KITH_VIBCH      KTICHCGRKANMVIRTDEHGNAIEGDQVAIGGNDKYVSVCRQHYKE-----
KITH_PHOPR      KTICHCGRKANMVIRQDEAGHAIAGDQVEIGGNDRYVSVCRKHYKE-----
KITH_HAEDU      KTICECGKKAHFVIRLNENGETVTGEQIQIGGNDKYISVCRYHYKK-----
KITH_VIBVU      KTICHCGRKANMVIRTDEHGKAIEGDQVAIGGNDRYVSVCRQHYKE-----
KITH_LEGPL      KTICHCGRKATMNMRIDENGQAVEGEQVLIGGNESYVATCRLHYKRGEAGK
KITH_VIBVY      KTICHCGRKANMVIRTDEHGNAIEGDQVAIGGNDRYVSVCRQHYKE-----
KITH_LEGPA      KTICHCGRKAIMNMRIDENGQAIEGEQVLIGGNESYVATCRLHYKRGEAGK
KITH_LEGPH      KTICHCGRKAIMNMRIDENGQAVEGEQVLIGGNESYVATCRLHYKRGEAE-
KITH_HAEIN      KTICYCGRKANFVLRLNDQGEVIEGAQIQIGGNDSYLSVCRLHYKE-----
KITH_HAEI8      KTICYCGRKANFVLRLNDQGEVIEGAQIQIGGNDSYLSVCRLHYKE-----
KITH_RHOBA      KTICHCGRKATMVLRVSESGQVIRGEQVQIGGNERYQTVCRLHFKEAIYQR
KITH_PASMU      KTICYCGRKANFVLRLNDKGEVVRGAQIQIGGNDSYLSVCRLHYKE-----
KITH_PSEHT      KTVCHCGRKANHVLRTDENGDAIAGNQVEIGGNNRYESVCRKHYK------
KITH_SHIDS      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_JANSC      RTICHCGRKATMVIRVGEDGNALEGAQIEVGGNDRYISLCRKHFRE-----
KITH_COXBU      KTICHCGRKATMNLRIDDEGNPIEGEQIRLGGNDRYTATCRKHFRLGQ---
KITH_YERPS      KTICHCGRKANMVLRLDEQGRAVHGEQVVIGGNESYVSVCRRHYKE-----
KITH_YERPE      KTICHCGRKANMVLRLDEQGRAVHGEQVVIGGNESYVSVCRRHYKE-----
KITH_SHISS      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_SHIFL      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_SHIBS      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_ERWCT      KTVCHCGRKANCVLRLDAQGNAVHGEQVVIGGNESYVSVCRKHYK------
KITH_ECOLI      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_ECOL6      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_ECO57      KTICFCGRKASMVLRLDQAGRPYEGEQVVIGGNERYVSVCRKHYKE-----
KITH_SALTY      KTICFCGRKASMVLRLDQDGRPYEGEQVVIGGNERYVSVCRKHYKD-----
KITH_SALTI      KTICFCGRKASMVLRLDQDGRPYEGEQVVIGGNERYVSVCRKHYKD-----
KITH_SALPA      KTICFCGRKASMVLRLDQDGRPYEGEQVVIGGNERYVSVCRKHYKD-----
KITH_SALCH      KTICFCGRKASMVLRLDQDGRPYEGEQVVIGGNERYVSVCRKHYKD-----
KITH_XANAC      KTICHSGSKATMTVRVDAHGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_BPT4       KAVCHCGKKAIMTARLMEDGTPVKEGNQICIGDEIYVSLCRKHWNE-----
KITH_XANC5      KTICHSGSKATMTVRVDAHGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_AGRT5      RTICHCGRKATMVARFDSEGKVVTGAQIEVGGNGKYVSFCRRHWVE-----
KITH_SILPO      RTICKCGRKATMVIRQDASGRAITGAQVQIGGNETYVSLCRKHWRE-----
KITH_XANOR      KTICHSGSKATMTVRVDAQGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_XANOM      KTICHSGSKATMTVRVDAQGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_SHEON      KTICHCGRKANMVVRLDGEGKVMEGEQVAIGGNESYESVCRKHFRE-----
KITH_PHOLL      KTICYCGRKANRVLRFDSEGAAIYGEQVDIGGNEKYVSVCRKHYME-----
KITH_RHIME      RTICHCGRKATMVVRLDGRGKVMEGAQVDVGGNEKYVSYCRRHWDD-----
KITH_NOVAD      KAVCHCGRKATMNLRVDDSGAAVAGRQTEIGGNDRYVALCRRHFSE-----
KITH_RHIEC      RTICHCGRKATMVVRLDAQGKVLHGAQIDVGGNEKYVSLCRRHWDD-----
KITH_COLP3      KTICHCGRKANFVIRQDANGKAVQGEQVEVGGNERYEPLCRAHFKQ-----
KITH_XANCP      KTICHSGSKATMTVRVDAQGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_XANC8      KTICHSGSKATMTVRVDAQGHAVQGPQVEIGGNERYVSVSRAEFKK-----
KITH_ZYMMO      KSVCFCGAKATMNLRVDENKKPIHGQQTEIGGNERYIALCRRHFIE-----
KITH_RHILO      RTICRCGRKATMVVRLGADGKVAQGEQVAI-GKDVYVSLCRRHWEE-----
KITH_FRATT      KTICHCGKKASFNM-MVQNGKAIKQGNPIVVDDDKYVSVCRKHWKEG----
KITH_FRATH      KTICHCGKKASFNM-MVQNGKAIKQGNPIVVDDDKYVSVCRKHWKEG----
KITH_BLOPB      KTICYCGRKANRVLRIDDQGLIIRGNQILVGGNNRYVSVCRKHFVE-----
KITH_STRP3      KTICYCSKKATMVLRI-ENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRPM      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRP8      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRP6      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRP1      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRMU      KTICFCSKKATMVLR-TENGRPVYGNQIQIGGNETYIPVCRRHY-------
KITH_STRGC      KTICYCSRKATMVLR-TDHGKPVYGEQIQIGGNETYIPVCRKHY-------
KITH_LACSS      KTICWCRKKAIMNLRMNNGLPVYTGEQIQIGGNEAYYPVCRKHYFNPPIQE
KITH_STRT2      KTICYCSRKATMVLRM-EDGEPVYGVQVQIGGHESYISVCRKHW-------
KITH_STRT1      KTICYCSRKATMVLRM-EDGEPVYGVQVQIGGHESYISVCRKHW-------
KITH_BLOFL      KTICYCGRQANRVLRIDNNGCVIAGSQIMFGDNNQYVSVCRKHF-------
KITH_STRR6      KTICYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVCRKHY-------
KITH_STRPN      KTICYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVCRKHY-------
KITH_STRA5      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRA3      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_STRA1      KTICYCSKKATMVLR-TENGKPVYGDQIQIGGNETYIPVCRKHY-------
KITH_LISMF      KTICWCAKKATMVLRVDDKGKPVYGEQIMIGGNDHYYPVCRK---------
KITH_LISMO      KTICWCAKKATMVLRVDDKGKPVYGEQIMIGGNDHYYPVCRK---------
KITH_LISIN      KTICWCAKKATMVLRVDDKGKPVYGEQIMIGGNDHYYPVCRK---------
KITH_LACLA      KTICWCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVCRKHYFKPEI--
KITH_CHRVO      KTICHCGRKATMHIRIDGDGRRVEGPQVEIGGEARYRAVCGR---------
KITH_LACPL      KTICWCRKKAIMNLRFHDGQPVYEGEQVQIGGNEAYYPVCRHHY-------
KITH_BACSK      KTICWCHKKAIMNLRVDEQGKPIYGEQIQIGGNETYYPVCRK---------
KITH_RHOFD      RAVCGCGKKATMNARLDATGARVAGEQTLIGGNERYIAMCPR---------
KITH_LACJO      KTICYCGHKATMNLRINSGKPVYEGEQVQIGGDESYYPVCRFHY-------
KITH_LACAC      KTICYCGHKATMNLRINNGKPVYEGEQVQIGGDESYYPVCRYHY-------
KITH_ENTFA      KTICWCHKKATMNLHYIDGNPVYEGDQVQIGGNEAYYPVCRKHY-------
KITH_ENCCU      DIVCYCKADGRFHLKYANGKAVVEGPSISIPGDGKFVAVCHMCWTE-----
KITH_PROAC      SPLCWCGRPATHNARIVDEXXXXXXXXXXXXSEIHYEVLCRRHHRQG----
KITH_STRAW      EAMCWCGARATHNAR------------------------------------
KITH_STRCO      EALCWCGARATHNAR------------------------------------
KITH_PYRAE      SAVCLCGKPATRTQRLNGVPAPRHSPRILIGGNESYEARCRRHY-------
KITH_THELT      KAVCHCGENATLTYKFVQDDSEI-----DIGGKEKYIAVCR----------
KITH_THEP1      KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
KITH_PYRKO      TAVCTCGKPATRSQRLDGKPAPRNSPVILVGGRESYEARCREH--------
KITH_THESQ      KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
KITH_THEMA      KAVCHCGENATLTLKVAGGEEEI-----DVGGQEKYIAVCR----------
KITH_AMEPV      QAICFCYKDASFTIKKHNKNQII-----EIGGQDLYVPVCR----------
KITH_UREU1      TAICECGAEATHSLRKIDGKYANYDDEVKIGCQEFYSAVCRHHHK------
KITH_STAAW      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAAS      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAAR      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAAC      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAAB      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAA3      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_MYCPN      DAVCVCGQLAQRTQRIVSKSNE----TVLIGDIEAYEPRCKLH--------
KITH_UREPA      TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
KITH_UREP2      TAICECGAEATHSLRKIDGKHADYNDDVKIGCQEFYSAVCRHHHK------
KITH_STAAN      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_STAAM      QAVCVCGSSSSRTQRLNGKPAKIDDPIILVGANESYEPRCRAH--------
KITH_THEPX      TAICKCGNPATRTQRLNGKPAKYDDPIILVGAHETYEARCRK---------
KITH_THEP3      TAICKCGNPATRTQRLNGKPAKYDDPIILVGAHETYEARCRK---------
KITH_MYCCT      RARCLCGSFANRSQRIVNGQPALWSPLILVDGKESYEARCRK---------
KITH_BACLD      QAVCVCGSPASRTQRLNGKPASYDDPVILVGASEAYEARCRHH--------
KITH_FOWPV      TAICKCYCDASFSKRVTENKEV-----MDIGGKDKYIAVCRK---------
KITH_BACA2      QAVCVCGSPASRTQRLIDGKPASYDPVILVGASESYEARCRHH--------
KITH_CLOTE      QAVCMCGNPATRTQRLNGKPAKYDDPVVLVGAKESYEARCRK---------
KITH_CFEPV      QSICFCYNDATFTMK--KFNKDI---IIEIGGSDLYIPVCRICYNE-----
KITH_ONYPE      TSICISGKKANRTQRLID-GKPAQSPVVLVGGKEYHEPRCRKH--------
KITH_STAHJ      QAVCVCGSSSSRTQRLDGQPAKVDDPIILVGANESYEPRCRAH--------
KITH_STAES      QAVCVCGSPSSRTQRLNGEPAKVDDPIILVGANESYEPRCRAH--------
KITH_STAEQ      QAVCVCGSPSSRTQRLNGEPAKVDDPIILVGANESYEPRCRAH--------
KITH_MYCA5      QAICKCQHAASTSFR------KVAASEINLLGDQEYEARCRKCHNAGQKEK
KITH_THETN      TAICKCGNPATRTQRLNGKPAKYDDPIILVGAHETYEARCRK---------
KITH_CBEPV      QSICFCYNDATFTMK--KFNKDI---IIEIGGSDLYIPVCRICYNE-----
KITH_STAS1      QAVCVCGASSSRTQRLDGNPAKIDDPVILVGANESYEPRCRAH--------
KITH_CLOAB      QAICVCGNPATRTQRLINGKPAFYDPVVLIGAMESYEARCRK---------
KITH_ANOFW      QAVCTCGSPASRTQRLNGRPASYYDPVILIGASESYEPRCRHH--------
KITH_MYCMO      KAVCFCKNAGTHTFRINDKDQKL------LGDTESYQARCRKCHLEGEEQK
KITH_CLOBJ      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_CLOB6      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_BACHD      QAICVCGSPASRTQRLIDGKPASYDPIILVGAAEAYEPRCR----------
KITH_OCEIH      NAICICGSPASRTQRLIDGKPASYNPIILVGASESYEPRCRHH--------
KITH_CLOBM      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_DEIRA      TAICTCGAPATRTQRL-----------------------------------
KITH_BACC4      QAVCVCGSPASRTQRLIDGDPAAFDPIILVGASESYEPRCR----------
KITH_ORYSJ      TARCLCGRRAFFTLRKTRETKT-----ELIGGADVYMPVCRQHYLDGQI--
KITH_GEOSW      QAVCTCGSPASRTQRLNGVPASYYDPVILVGASESYEPRCRHH--------
KITH_CLOBL      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_CLOBK      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_CLOBH      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_CLOB1      QAVCMCNNPATRTQRLNGKPAKKSDPVVLIGAQESYEARCRK---------
KITH_BACCZ      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACCR      QAVCVCGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACC2      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACAN      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACAC      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACAA      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACHK      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACCQ      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACC7      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACC3      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACC1      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACC0      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACAH      QAVCACGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_BACSU      QAVCVCGSPASRTQRLIDGKPASYDPVILVGAAESYEARCRHHHEPGKSKK
KITH_BACCN      QAVCVCGSPASRTQRLNDEPAAFDDPIILVGASESYEPRCR----------
KITH_COPPD      HAICVCGNIATKTQRLNGRPARYDDPTILVGGLETYEARCNLH--------
KITH_MYCGA      TAICECGAEASRSQRLIDNQPADYNETILIGDTESYAPRCRHHHK------
KITH_BACWK      QAVCECGSPASRTQRLIDGEPAAFDPIILVGASESYEPRCR----------
KITH_AYWBP      TSICISGGKANRTQRLIE-GKPAQSPVVLVGGKEYHEPRCRKH--------
KITH_GEOTN      QAVCTCGSPASRTQRLNGAPASYDDPIILVGASEAYEPRCRHH--------
KITH_MYCHJ      QAVCLCKRAATTTARLNE-------AQTLIGDQDEYEARCR----------
KITH_MYCH7      QAVCLCKRAATTTARLNE-------AQTLIGDQDEYEARCR----------
KITH_MYCH2      QAVCLCKRAATTTARLNE-------AQTLIGDQDEYEARCR----------
KITH_MYCGE      DAICVCGSLAQRTQRLVNKNTN--DNLVLIGDAEAYEARCKLH--------
KITH_DICDI      TAVCMCYNEAAFSKRIVESDD-----IELIGGIDKYISVCR----------
KITH_MYXVL      NAVCYCYKDASFSKRLGNETE-----IEIIGGSDKYKSVCRK---------
KITH_GEOKA      QAVCTCGSPASRTQRLNGAPASYDDPVILVGASEAYEPRCRHH--------
KITH_BACNA      RISRGC--EASKCSKIAQYNARIVDGKVSRSGKSYYLALCSDHY-------
KITH_MYCPE      SAICTCGAPGTATQRINDKPSNYDEPVVQIGNYETYTVKCRHHHK------
KITH_ROSS1      YAICRCGAYATRSQRLDGKPAPADAPTIVVGGQELYEARCR----------
KITH_MACCJ      QAVCVCGAPSSRTQRLIDGPAKFDDPIILVGAKESYEPRCREH--------
KITH_MYXVU      NAVCYCYKDASFSKRLGNETE-----IEIIGGSDKYKSVCRK---------
KITH_RFVKA      NAVCYCYKNGSFSKRLGDKMEI-----EVIGGSDKYKSVCRK---------
KITH_MOUSE      TAVCMCFREAAYTKRLGLEKEV-----EVIGGADKYHSVCR----------
KITH_DEIDV      TAICQCGAPATRSQRLSGEPARFDDPVVLVGALESYEARCRLH--------
KITH_BACP2      QAVCVCGSPASRTQRLIDGKPASYDPIILVGAQESYEARCRHH--------
KITH_MYCMS      RARCLCGNFANRSQKIVNGQPALWSPLILVDGKESYEARCR----------
KITH_CRIGR      TAVCMCFREAAYTKRLGLEKEV-----EVIGGADKYHSVCRCYFKKSSVQ-
KITH_CHLAD      YAICKCGAYATRSQRLDGKPAPANAPTIVVGGLDMYEARCR----------
KITH_ROSCS      YAICRCGAYATRSQRLDGKPAPADAPTIVVGGQELYEARCR----------
KITH_BDEBA      HAVCVCGAPASRTQR-TAGGDG----QVLVGTHDAYEARCRQHFK------
KITH_HUMAN      TAVCMCFREAAYTKRLGTEKEV-----EVIGGADKYHSVCR----------
KITH_MIMIV      KAICMGCKDASFTIRTIESDEKIL-----VGGIDKYQSVCRK---------
KITH_CHLSY      YAICKCGAYATRSQRLDGKPAPADAPTIVVGGLDMYEARCR----------
KITH_CHLAA      YAICKCGAYATRSQRLDGKPAPADAPTIVVGGLDMYEARCR----------
KITH_CHICK      NAVCMCYREASYTKRLGAEREV-----EVIGGADKYHSVCR----------
KITH_MONPV      TAVCMCFKEASFSKRLGAETEI-----EIIGGNDMYQSVCRK---------
KITH_BOVIN      TAVCMCFREAAYTKRLGVEKEV-----EVIGGADKYHSVCR----------
DNAA_MYCMS      ---------------------------------------------------