[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81437.1

[Show Plain Result]


## Summary of Sequence Search
    1::122
    1::125     1e-34  58%  125 aa  GRCA_VIBHB RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-34  57%  125 aa  GRCA_VIBPA RecName: Full=Autonomous glycyl radical cofactor;
    4::120     2e-34  61%  120 aa  GRCA_BPT4 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     4e-34  58%  125 aa  GRCA_VIBVY RecName: Full=Autonomous glycyl radical cofactor;
    1::125     4e-34  58%  125 aa  GRCA_VIBVU RecName: Full=Autonomous glycyl radical cofactor;
    1::128     7e-34  61%  128 aa  GRCA_HAEDU RecName: Full=Autonomous glycyl radical cofactor;
    1::128     9e-34  61%  128 aa  GRCA_ACTPJ RecName: Full=Autonomous glycyl radical cofactor;
    1::128     9e-34  61%  128 aa  GRCA_ACTP7 RecName: Full=Autonomous glycyl radical cofactor;
    1::128     9e-34  61%  128 aa  GRCA_ACTP2 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     5e-33  57%  125 aa  GRCA_VIBCM RecName: Full=Autonomous glycyl radical cofactor;
    1::125     5e-33  57%  125 aa  GRCA_VIBCH RecName: Full=Autonomous glycyl radical cofactor;
    1::125     5e-33  57%  125 aa  GRCA_VIBC3 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     5e-33  55%  125 aa  GRCA_ALISL RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPY RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPP RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPN RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPG RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPE RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPB RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERPA RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_YERP3 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-33  60%  127 aa  GRCA_PROMH RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-32  55%  125 aa  GRCA_VIBFM RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-32  55%  125 aa  GRCA_VIBF1 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-32  61%  127 aa  GRCA_HAES2 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-32  61%  127 aa  GRCA_HAES1 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-32  55%  125 aa  GRCA_VIBSL RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-32  60%  127 aa  GRCA_ERWT9 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-32  60%  127 aa  GRCA_HAEPS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     3e-32  62%  127 aa  GRCA_ACTSZ RecName: Full=Autonomous glycyl radical cofactor;
    1::127     4e-32  61%  127 aa  GRCA_PASMU RecName: Full=Autonomous glycyl radical cofactor;
    1::127     4e-32  59%  127 aa  GRCA_HAEIN RecName: Full=Autonomous glycyl radical cofactor;
    1::127     4e-32  59%  127 aa  GRCA_HAEIG RecName: Full=Autonomous glycyl radical cofactor;
    1::127     7e-32  60%  127 aa  GRCA_ENTS8 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     9e-32  61%  127 aa  GRCA_CITK8 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_YERE8 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-31  54%  125 aa  GRCA_PHOPR RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_HAEIE RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_HAEI8 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALTY RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALTI RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALSV RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALPK RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALPC RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALPB RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALPA RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALNS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALHS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALG2 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALEP RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALCH RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALAR RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-31  58%  127 aa  GRCA_SALA4 RecName: Full=Autonomous glycyl radical cofactor;
    1::125     1e-31  55%  125 aa  GRCA_PSYIN RecName: Full=Autonomous glycyl radical cofactor;
    1::127     3e-31  58%  127 aa  GRCA_SALDC RecName: Full=Autonomous glycyl radical cofactor;
    1::127     3e-31  59%  127 aa  GRCA_MANSM RecName: Full=Autonomous glycyl radical cofactor;
    1::127     4e-31  57%  127 aa  GRCA_ENT38 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-30  57%  127 aa  GRCA_PECCP RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-30  57%  127 aa  GRCA_SERP5 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-30  57%  127 aa  GRCA_KLEP7 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-30  57%  127 aa  GRCA_KLEP3 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     4e-30  58%  127 aa  GRCA_EDWI9 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     5e-30  57%  127 aa  GRCA_SERLI RecName: Full=Autonomous glycyl radical cofactor;
    1::127     8e-30  56%  127 aa  GRCA_ERWCT RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_SHISS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_SHIF8 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_SHIBS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_SHIB3 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECOSE RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECOLI RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECOLC RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECOHS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECODH RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECOBW RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO8A RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO81 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO5E RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO57 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO55 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     6e-28  54%  127 aa  GRCA_ECO24 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     1e-27  53%  127 aa  GRCA_SHIDS RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ESCF3 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECOSM RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECOLU RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECOL6 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECOL5 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECOK1 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECO7I RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECO45 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     2e-27  53%  127 aa  GRCA_ECO27 RecName: Full=Autonomous glycyl radical cofactor;
    1::127     5e-27  53%  127 aa  GRCA_SHIFL RecName: Full=Autonomous glycyl radical cofactor;
  707::770     2e-25  80%  770 aa  PFLB_HAEIN RecName: Full=Formate acetyltransferase;       
  697::760     3e-25  78%  760 aa  PFLB_ECOLI RecName: Full=Formate acetyltransferase 1;       
  701::764     5e-24  78%  764 aa  TDCE_ECOLI RecName: Full=Keto-acid formate acetyltransferase;      
  681::740     4e-18  63%  740 aa  PFL_CLOPA RecName: Full=Formate acetyltransferase;       
  688::748     5e-18  64%  748 aa  PFLB_STAES RecName: Full=Formate acetyltransferase;       
  688::748     5e-18  64%  748 aa  PFLB_STAEQ RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAW RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAS RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAR RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAN RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAM RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAC RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAAB RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAA8 RecName: Full=Formate acetyltransferase;       
  692::749     7e-18  67%  749 aa  PFLB_STAA3 RecName: Full=Formate acetyltransferase;       
  137::195     2e-17  64%  195 aa  PFL_CHLRE RecName: Full=Formate acetyltransferase;       
  751::806     1e-10  45%  810 aa  PFLF_ECOLI RecName: Full=Putative formate acetyltransferase 3;     
  707::762     5e-08  43%  775 aa  PFL_STRMU RecName: Full=Formate acetyltransferase;       
  720::774     9e-08  42%  787 aa  PFL_LACLM RecName: Full=Formate acetyltransferase;       
  720::774     9e-08  42%  787 aa  PFL_LACLA RecName: Full=Formate acetyltransferase;       
  710::764     9e-08  42%  765 aa  PFLD_ECOLI RecName: Full=Formate acetyltransferase 2;       
    1::122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIGFQLLDGSNDHGSIFLVDDQTNNAKVIASKTYEIDTIVEDSVIRGRPGRFFDVQPEPTVEGGQHLNV
GRCA_VIBHB      MIQGIQITKAANDENSIWLLDSEKNEARVAAASTYEADQVIAISDLGDYESREVAIETAPRIEGGQHLNV
GRCA_VIBPA      MIQGIQITKAANDENSIWLLDSEKNEARCVAAATYEADQVIAISDLGEYESREVAIETAPRIEGGQHLNV
GRCA_BPT4       ----YQILEGTHK-GTIYFEDGI--QARIIVSKTFKEDSFVDPEIFYGLHAREIEIEPQPTVEGGQHLNV
GRCA_VIBVY      MIQGIQITKAANDDNSIWLLDSEKNEARCVAAVSYEADQIVAINELGEFESREVAIEAAPRIEGGQHLNV
GRCA_VIBVU      MIQGIQITKAANDDNSIWLLDSEKNEARCVAAVSYEADQIVAINELGEFESREVAIEAAPRIEGGQHLNV
GRCA_HAEDU      MIKGIQITESSNNNNSFWLLDEEKNEARCIAAKVYQEDQVIAINELGQIAYREIPVNIAPTVEGGQHLNV
GRCA_ACTPJ      MIKGVQITESSNSNNSFWLLDEEKNEARCIAAKVYKEDQVIAISELGQIAYREVPVNVAPTVEGGQHLNV
GRCA_ACTP7      MIKGVQITESSNSNNSFWLLDEEKNEARCIAAKVYKEDQVIAISELGQIAYREVPVNVAPTVEGGQHLNV
GRCA_ACTP2      MIKGVQITESSNSNNSFWLLDEEKNEARCIAAKVYKEDQVIAISELGQIAYREVPVNVAPTVEGGQHLNV
GRCA_VIBCM      MIQGIQITKAANDDNSIWLLDSEKNEARCVAAKGFEADQVVSINDLGQFESREVAIEAAPRIEGGQHLNV
GRCA_VIBCH      MIQGIQITKAANDDNSIWLLDSEKNEARCVAAKGFEADQVVSINDLGQFESREVAIEAAPRIEGGQHLNV
GRCA_VIBC3      MIQGIQITKAANDDNSIWLLDSEKNEARCVAAKGFEADQVVSINDLGQFESREVAIEAAPRIEGGQHLNV
GRCA_ALISL      MITGIQITKAANDDNSIWLLDSEKNEARVVATSGFEADQVIATSALGEYESRDVAIEKAPKVEGGQHLNV
GRCA_YERPY      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPS      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPP      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPN      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPG      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPE      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPB      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERPA      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_YERP3      MITGIQITKANNEANSFWLLDDEKAELRCVCAKSYAEDQIVPTSELGEIEYRELEVQPTVRVEGGQHLNV
GRCA_PROMH      MITGIQITKADNDDHSFWLLDDENGEARCIAKKGFEEGQVVSRDALGNIEYREVPVESKPVVEGGQHLNV
GRCA_VIBFM      MITGIQITKAANDDNSIWLLDSEKNEARVVATAGFEADQVIAASELGEYESRDVAIEKAPKIEGGQHLNV
GRCA_VIBF1      MITGIQITKAANDDNSIWLLDSEKNEARVVATAGFEADQVIAASELGEYESRDVAIEKAPKIEGGQHLNV
GRCA_HAES2      MIKGIQITQAANDNNSFWLLDSEKGEARCLAAKAEFVDQIVAVSELGQIEYRELPVDVAPTVEGGQHLNV
GRCA_HAES1      MIKGIQITQAANDNNSFWLLDSEKGEARCLAAKAEFVDQIVAVSELGQIEYRELPVDVAPTVEGGQHLNV
GRCA_VIBSL      MIQGIQITKAANDDNSIWLLDSEKNEARVVATSGFEADQVISAADLGEYESREVAIEAAPRIEGGQHLNV
GRCA_ERWT9      MITGIQITRSANSHNSFWLLDSETAQARVCANAGYSEDQVVAVSDLGQIEYREIDVKPQVRVEGGQHLNV
GRCA_HAEPS      MIKGVQITESTNKNNSFWLLDEEKNEARCLVAKDFQEDQIVAISELGQVSYREVPVNVAPTVEGGQHLNV
GRCA_ACTSZ      MIKGIQITQAANDSNSFWLLDSDKGEARCLAAKS----GFAEDQVVASELGQFLDVQPSVKVEGGQHLNV
GRCA_PASMU      MIKGIQITQAANDNNSFWLLDSEKGEARCLCAK----GDFVEDQIVASELGQIVDIAPTVKVEGGQHLNV
GRCA_HAEIN      MIKGIQITQAANDNNSFWLLDSEKNEARCLCAKEFAEDQVVAVSELGQIEYRELPVNVAPTVEGGQHLNV
GRCA_HAEIG      MIKGIQITQAANDNNSFWLLDSEKNEARCLCAKEFAEDQVVAVSELGQIEYRELPVNVAPTVEGGQHLNV
GRCA_ENTS8      MITGIQITKAANDSNSFWLLDNEKGEARCVCAKAFNEDDIVPVSQL----GQFMEIKPEVRVEGGQHLNV
GRCA_CITK8      MITGIQITKAANDDNSFWLLDSEKGEARCIAAKA----GFAEDEVVANKLGEIMEVKPEVRVEGGQHLNV
GRCA_YERE8      MITGIQITKANNEANSFWLLDDEKAELRCVCAKAYAEDQIVPASELGQIEYREIPLEVQPTVEGGQHLNV
GRCA_PHOPR      MITGIQITKSANDDNSIWLLDSETNEARCVVAKAFEEDQVIAAADLGEYESRDVAIEVPAKVEGGQHLNV
GRCA_HAEIE      MIKGIQITQAANDNNSFWLLDSEKNEVRCLCAKEFAEDQVVAVSELGQIEYRELPVNVAPTVEGGQHLNV
GRCA_HAEI8      MIKGIQITQAANDNNSFWLLDSEKNEVRCLCAKEFAEDQVVAVSELGQIEYRELPVNVAPTVEGGQHLNV
GRCA_SALTY      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALTI      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALSV      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALPK      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALPC      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALPB      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALPA      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALNS      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALHS      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALG2      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALEP      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALCH      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALAR      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_SALA4      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKSFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_PSYIN      MIQGIQITKSDNENNSIWLIDNEKNEARLVAPAQYKEDQVVPASELGEYESREVAIEAPKAQEGGQHLNV
GRCA_SALDC      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKPFAEDEVVAVSKLGEIEYREIEVKPEVRVEGGQHLNV
GRCA_MANSM      MIKGIQITKAANDNNSFWLLDSDKGEARCLAAKAFAEDQIVAINELGQIEYRELAVDVAPTVEGGQHLNV
GRCA_ENT38      MITGIQITKAANDDNSFWLLDSEKGEARCVVAKAFAEDQIVPVNKLGEIEYREIEIQPEVRVEGGQHLNV
GRCA_PECCP      MVTGIQITKANDSANSFWLLDEEKSQARCVCAKSYSEDQIVPVSDLGQIEYREIEIKPEVRVEGGQHLNV
GRCA_SERP5      MITGIQITKANDQANSFWLLDDEKSEARCVCAKAYAEDQVVPVSELGQIEYREVPLEMQSTVEGGQHLNV
GRCA_KLEP7      MITGIQITKAANDDNSFWLLDSEKGEARCLCAKGFAEDDVVAVSKLGEIEYREIDVKPEVRVEGGQHLNV
GRCA_KLEP3      MITGIQITKAANDDNSFWLLDSEKGEARCLCAKGFAEDDVVAVSKLGEIEYREIDVKPEVRVEGGQHLNV
GRCA_EDWI9      MIKGIQITKADNADNSFWLLDTEKGAARCLCAKGYAEDQMVALDELGAFESRDLDVAPSVRVEGGQHLNV
GRCA_SERLI      MITGIQITKANDQANSFWLLDDEKAEARVCANGQYAEDQVVAVSDLGQIEYREVPLEMQPTVEGGQHLNV
GRCA_ERWCT      MVTGIQITKANDSANSFWLLDEEKSQARCVCAKSYSEDQIVPMSDLGQIEYREIEIKPEVRVEGGQHLNV
GRCA_SHISS      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_SHIF8      MITGIQITKAANDDNSFWLLDSEQGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_SHIBS      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_SHIB3      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOSE      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOLI      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOLC      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOHS      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECODH      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOBW      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO8A      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO81      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO5E      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO57      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO55      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO24      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_SHIDS      MITGIQITKAANDDNSFWLLDSEKDEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ESCF3      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOSM      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOLU      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOL6      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOL5      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECOK1      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO7I      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO45      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_ECO27      MITGIQITKAANDDNSFWLLDSEKGEARCIVAKAFAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
GRCA_SHIFL      MITGIQITKAANADNSFWLLDSEKGEARCIVAKAYAEDEVVAVSKLGDXXXXXXXXXXXXXXXGGQHLNV
PFLB_HAEIN      ----------------------------------------------------------EATVEGGQHLNV
PFLB_ECOLI      ----------------------------------------------------------EASIEGGQHLNV
TDCE_ECOLI      ----------------------------------------------------------EADVEGGQHLNV
PFL_CLOPA       --------------------------------------------------------------QGAHHLNV
PFLB_STAES      -------------------------------------------------------------MQHGHHLNI
PFLB_STAEQ      -------------------------------------------------------------MQHGHHLNI
PFLB_STAAW      ----------------------------------------------------------------GHHLNI
PFLB_STAAS      ----------------------------------------------------------------GHHLNI
PFLB_STAAR      ----------------------------------------------------------------GHHLNI
PFLB_STAAN      ----------------------------------------------------------------GHHLNI
PFLB_STAAM      ----------------------------------------------------------------GHHLNI
PFLB_STAAC      ----------------------------------------------------------------GHHLNI
PFLB_STAAB      ----------------------------------------------------------------GHHLNI
PFLB_STAA8      ----------------------------------------------------------------GHHLNI
PFLB_STAA3      ----------------------------------------------------------------GHHLNI
PFL_CHLRE       ---------------------------------------------------------------GGHHINV
PFLF_ECOLI      -------------------------------------------------------------VHKGWHIQY
PFL_STRMU       ---------------------------------------------------------------GGQHVNL
PFL_LACLM       ----------------------------------------------------------------GQHVNL
PFL_LACLA       ----------------------------------------------------------------GQHVNL
PFLD_ECOLI      -----------------------------------------------------------------QHIQF


                         .         .         *         .         .         .         .:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQSL
GRCA_VIBHB      NVLKRETLEDAVAHPENYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_VIBPA      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTETL
GRCA_BPT4       NVLRHETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_VIBVY      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_VIBVU      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_HAEDU      NVLRRETLEDAIKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ACTPJ      NVLRRETLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ACTP7      NVLRRETLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ACTP2      NVLRRETLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_VIBCM      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTAEQQRDVIARTFTESL
GRCA_VIBCH      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTAEQQRDVIARTFTESL
GRCA_VIBC3      NVLKRETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTAEQQRDVIARTFTESL
GRCA_ALISL      NVLQRDTLQDAVKHPEKYPQLTIRVSGYAVRFNSLTTEQQQDVIARTFTETL
GRCA_YERPY      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPS      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPP      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPN      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPG      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPE      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPB      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERPA      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_YERP3      NVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_PROMH      NVLSRETLEDAVNNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_VIBFM      NVLQRDTLEDAVKHPENYPQLTIRVSGYAVRFNSLTTEQQKDVIARTFTESL
GRCA_VIBF1      NVLQRDTLEDAVKHPENYPQLTIRVSGYAVRFNSLTTEQQKDVIARTFTESL
GRCA_HAES2      NVLRRETLEDAVNNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTQSL
GRCA_HAES1      NVLRRETLEDAVNNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTQSL
GRCA_VIBSL      NVLKRETLEDAVAHPENYPQLTIRVSGYAVRFNSLTTEQQRDVIARTFTESL
GRCA_ERWT9      NVLSRETLEEAVENPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTDSL
GRCA_HAEPS      NVLRRETLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ACTSZ      NVLRRETLEDAVKHPENYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_PASMU      NVLRRETLEDAVNNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTQSL
GRCA_HAEIN      NVLRRETLEDAVNNPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_HAEIG      NVLRRETLEDAVNNPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ENTS8      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_CITK8      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_YERE8      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_PHOPR      NVLKKETLEDAVAHPEKYPQLTIRVSGYAVRFNSLTTEQQKDVIARTFTSSL
GRCA_HAEIE      NVLRRETLEDAVNNPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_HAEI8      NVLRRETLEDAVNNPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_SALTY      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALTI      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALSV      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALPK      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALPC      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALPB      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALPA      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALNS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALHS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALG2      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALEP      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALCH      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALAR      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SALA4      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_PSYIN      NVLKRETLEDAIKHPENYPQLTIRVSGYAVRFNSLTPEQQQDVLTRTFTESL
GRCA_SALDC      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_MANSM      NVLRRETLEDAVNNPDKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_ENT38      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTASL
GRCA_PECCP      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SERP5      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
GRCA_KLEP7      NVLRRETLLDAVEHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_KLEP3      NVLRRETLLDAVEHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_EDWI9      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTQSL
GRCA_SERLI      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ERWCT      NVLRRETLEDAVKHPENYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTASL
GRCA_SHISS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SHIF8      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SHIBS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SHIB3      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOSE      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOLI      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOLC      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOHS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECODH      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOBW      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO8A      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO81      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO5E      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO57      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO55      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO24      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SHIDS      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ESCF3      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOSM      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOLU      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOL6      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOL5      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECOK1      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO7I      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO45      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_ECO27      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
GRCA_SHIFL      NVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIARTFTESL
PFLB_HAEIN      NVLNREMLLDAMENPDKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTESM
PFLB_ECOLI      NVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
TDCE_ECOLI      NVMNREMLLDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQDVISRTFTQAL
PFL_CLOPA       NVLNRETLIDAMNNPDKYPTLTIRVSGYAVNFNRLSKDHQKEVISRTFHEKL
PFLB_STAES      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAEQ      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAW      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAS      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAR      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAN      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAM      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAC      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAAB      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAA8      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFLB_STAA3      NVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM
PFL_CHLRE       NVLNRSMLMDAVEHPEKYPNLTIRVSGYAVHFARLTREQQLEVIARTFHDTM
PFLF_ECOLI      NIVSRETLLDAKKHPDQYRDLVVRVAGYSAFFTALSPDAQDDIIART-----
PFL_STRMU       NVMDLKDVYDKIMNGE---DVIVRISGYCVNTKYLTKEQKTELTQRVFHEVL
PFL_LACLM       NVMDLKDVYDKIMRGE---DVIVRISGYCVNTKYLTPEQKQELTERVFHEVL
PFL_LACLA       NVMDLKDVYDKIMRGE---DVIVRISGYCVNTKYLTPEQKQELTERVFHEVL
PFLD_ECOLI      NVVNADTLREAQQRPQDYAGLVVRVAGYSAFFVELSKEIQDDIIRRTAHQ--