[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81502.1

[Show Plain Result]


## Summary of Sequence Search
    1::342
    4::361     5e-94  52%  364 aa  VG48_BPT4 RecName: Full=Tail-tube assembly protein Gp48;
  125::310     6e-04  27%  323 aa  ANXA3_BOVIN RecName: Full=Annexin A3;AltName:
    1::342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVQDVVKGILKGENPAGGSTPRQPLSKITIAQFPAERNAANDSTQDFNVNDLYKNGLLLSA
VG48_BPT4       ----------VKEITADLIKGEKSAGQSTKSEVGTKTYTAQFPTGRASGNDTTEDFQVTDLYKNGLLFTA
ANXA3_BOVIN     ---------------------------------MQEIGHAYYTAYKKSLGDEISSETSGDFRKALLILAN


                         .         .         *         .         .         .         .:140
query           FNYSGRQTGDLRSFRTDQNNIGDYRKGVVKEAIANILMPKGQTDIDTINHKFNDVQQSLVERGNGSITGA
VG48_BPT4       YNMSSRDXXXXXXLRTARNTISSXXXXXXKSPIANILLPRSKSDVDTSSHRFNDVQESLISRGGGTATGV
ANXA3_BOVIN     GRRDESLKVDEQLARKDAQNAGEKRWGTDEDAFTNILCLRSFPQLKLTFDEYRNISQKDIE---DSIKGE


                         +         .         .         .         .         *         .:210
query           LSSMASHAVYGGLESITQGAFADRGEQVYIASRAMYAGAENRTKTYTWQLTPRNVYDLVEIIKIYEMLSY
VG48_BPT4       LSNIASTAVFGALESITQGIMADNNEQIYTTARSMYGGAENRTKVFTWDLTPRSTEDLMAIINIYQYFNY
ANXA3_BOVIN     LS--------GHFEDLLLAIVCARNTPAFLAERLYRAGAGTDEFTLNRIMVSRSEIDLLDIRAEFKKLSG


                         .         .         .         +         .         .         .:280
query           YSYGSVEKSNTANDIRKSVDAAYKETIINPLTPEATHGQTTMFERITSFLSNVNVVSNPIIWTIRNFGQS
VG48_BPT4       FSYGETGKSQYAAEIKGYLDDWYRSTLIEPLSPEDAAKNKTLFEKMTSSLTNVLVVSNPTVWMVKNFGAT
ANXA3_BOVIN     YSLYSAIKSDTSGD--------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSFDSRSDIFGPAQIQSIRFDKSPDGHFGGLAVAPNLPSSFVLEVTFREILALNRSDLYSxx
VG48_BPT4       SKFDGKTEIFGPCQIQSIRFDKTPNGNFNGLAIAPNLPSTFTLEITMREIITLNRASLYA--
ANXA3_BOVIN     --------------------------------------------------------------