[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81503.1

[Show Plain Result]


## Summary of Sequence Search
    1::285
    1::275     2e-89  59%  320 aa  VG54_BPT4 RecName: Full=Tail-tube assembly protein Gp54;
  410::503     2e-04  28%  520 aa  ARP4_KLULA RecName: Full=Actin-related protein 4;AltName:
    1::285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MYRLDEFQQELNKDFQRSNMFSVVFATTPSSKTTELLDGFGGFLYNNLPFGKDFAGLTQGMISSSLNKII
VG54_BPT4       MYSLEEFNQAINADFQRNNMFSCVFATTPXXXXXXXXXXXXXXXYNNLGLNSDWLGLTQGDINQGITTLI
ARP4_KLULA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQFEVGTYLLDFFNAGNTHTGLTVYSVQMPENRLGYEMDK
VG54_BPT4       TAGTQKLIRKSGVSKYLIGAMSQRTVQSLLGSFTVGTYLIDFFNMAYNSSGLMIYSVKMPENRLSYETDW
ARP4_KLULA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FHNAPNIKLMGREYDPLVISFRMDHQASNYRAMQDWVNAVEDPVTGLRSLPADVEADIQINLHARDGIPH
VG54_BPT4       NYNSPNIRITGRELDPLVISFRMDSEACNYRAMQDWVNSVQDPVTGLRALPQDVEADIQVNLHSRNGLPH
ARP4_KLULA      ----------------------------------------EDEVAGIVDLKSMMEADVDL----RATLAH


                         .         .         .         +         .         .         .:280
query           TVTMFGGCIPVAVSSPELSYEDNNTITTFNVTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGGWLSK
VG54_BPT4       TAVMF-TMHSISVSAPELSYDGDNQITTFDVTFAYRVMQAGAVDRQRALEWLESAAINGIQSVLG-----
ARP4_KLULA      NVVLTGGTSKIPGLSDRIMHELNKSLPALK----FRMLSSGHLRERQYQGWLGGSILASLGTFHQLWVGR


                         .         *         .         .         .         .         +:350
query           xxxxx
VG54_BPT4       -----
ARP4_KLULA      -----