[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81509.1

[Show Plain Result]


## Summary of Sequence Search
    1::234
    2::222     5e-41  42%  278 aa  Y12F_BPT4 RecName: Full=Uncharacterized 32.4 kDa protein in
   69::176     3e-04  30%  224 aa  PGP_THEAC RecName: Full=Phosphoglycolate phosphatase;       
    1::234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMREYNNS
Y12F_BPT4       ----KPTILTDIDGVCLSWQSGLPYFAQKYNLPLEHILKMIQDEKFISPGKLFNCDEELGVKLIEKYNRS
PGP_THEAC       -------IMFDNDGSIKKFFSGTNKFLEEMSKRTS--MRSILTNRWREASTGFDIDPEDVDYVRKEAESR


                         .         .         *         .         .         .         .:140
query           DFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFPGAFKDILCVDIGETKMPHYI
Y12F_BPT4       DFIRYLSPYKDALCVINKLKEDYNFVAVTALGDSIDALLNRQFNLNALFPGAFSEVLMCSHDSSKEELFK
PGP_THEAC       GFVIFYSGYEDKAFAVNKLKEMYEYDEILVIGDSN-----------------------------------


                         +         .         .         .         .         *         .:210
query           SVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTENAREVKHDIAKYHTAKNWYDIEKLLVNLNP
Y12F_BPT4       KAKEKY--NVICYIDDLAHHCDHASEIL-RVPVYWMARGERDNDVENKLFSPKENKESFDSEKAIKDVIE
PGP_THEAC       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KPIKMDxxxxxxxxxxxxxxxxxx
Y12F_BPT4       KMIKND------------------
PGP_THEAC       ------------------------