[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81516.1

[Show Plain Result]


## Summary of Sequence Search
    1::172
    1::173     6e-53  67%  188 aa  DCTD_BPT2 RecName: Full=Deoxycytidylate deaminase;       
    1::181     1e-52  66%  193 aa  DCTD_BPT4 RecName: Full=Deoxycytidylate deaminase;       
   11::136     2e-19  47%  189 aa  COMEB_BACSU RecName: Full=ComE operon protein 2;       
   14::124     5e-17  46%  128 aa  DCTD_BPMD2 RecName: Full=Deoxycytidylate deaminase;       
   11::147     1e-14  39%  147 aa  YLXG_VIBFI RecName: Full=Uncharacterized deaminase in luxG
  202::324     1e-14  35%  348 aa  DCTD_SCHPO RecName: Full=Deoxycytidylate deaminase;       
   23::127     5e-14  44%  178 aa  DCTD_RAT RecName: Full=Deoxycytidylate deaminase;       
   23::127     5e-14  44%  178 aa  DCTD_MOUSE RecName: Full=Deoxycytidylate deaminase;       
  165::298     7e-14  39%  312 aa  DCTD_YEAST RecName: Full=Deoxycytidylate deaminase;       
   23::127     7e-14  43%  178 aa  DCTD_HUMAN RecName: Full=Deoxycytidylate deaminase;       
   23::127     9e-14  43%  178 aa  DCTD_PONAB RecName: Full=Deoxycytidylate deaminase;       
   49::145     6e-12  49%  203 aa  DCTD_DROME RecName: Full=Probable deoxycytidylate deaminase;       
   55::182     4e-11  37%  197 aa  DCTD_CAEEL RecName: Full=Probable deoxycytidylate deaminase;       
  313::441     5e-07  32%  471 aa  CDAC1_DANRE RecName: Full=Cytidine and dCMP deaminase
   39::109     1e-06  49%  376 aa  RIBD_ACTPL RecName: Full=Riboflavin biosynthesis protein
   41::123     1e-06  32%  150 aa  FCA1_CANAL RecName: Full=Cytosine deaminase;       
   35::95      2e-06  42%  144 aa  Y1319_RICFE RecName: Full=Uncharacterized deaminase RF_1319;       
   48::95      2e-06  46%  145 aa  Y1426_RICBR RecName: Full=Uncharacterized deaminase RBE_1426;      
   36::95      2e-06  43%  153 aa  Y1285_RICCN RecName: Full=Uncharacterized deaminase RC1285;        
   26::96      2e-06  52%  361 aa  RIBD_BACSU RecName: Full=Riboflavin biosynthesis protein
   35::95      4e-06  40%  148 aa  Y819_RICTY RecName: Full=Uncharacterized deaminase RT0819;       
   25::102     4e-06  44%  151 aa  TADA_AQUAE RecName: Full=tRNA-specific adenosine deaminase;        
   48::95      5e-06  43%  148 aa  Y831_RICPR RecName: Full=Uncharacterized deaminase RP831;       
   47::96      5e-06  55%  371 aa  RIBD_BACAM RecName: Full=Riboflavin biosynthesis protein
   62::140     7e-06  38%  337 aa  RIBD_CORAM RecName: Full=Riboflavin biosynthesis protein
  341::447     7e-06  35%  515 aa  CDAC1_PONAB RecName: Full=Cytidine and dCMP deaminase
  341::447     7e-06  35%  515 aa  CDAC1_MACFA RecName: Full=Cytidine and dCMP deaminase
  340::446     7e-06  35%  514 aa  CDAC1_HUMAN RecName: Full=Cytidine and dCMP deaminase
   48::101     2e-05  48%  147 aa  RIBD1_BUCAP RecName:
   30::99      2e-05  48%  356 aa  RIBD_AQUAE RecName: Full=Riboflavin biosynthesis protein
  363::447     3e-05  35%  523 aa  CDAC1_MOUSE RecName: Full=Cytidine and dCMP deaminase
  406::461     6e-05  37%  507 aa  TILS_THET8 RecName: Full=tRNA(Ile)-lysidine synthase;       
  406::461     6e-05  37%  507 aa  TILS_THET2 RecName: Full=tRNA(Ile)-lysidine synthase;       
   39::100     8e-05  40%  161 aa  TADA_BACSU RecName: Full=tRNA-specific adenosine deaminase;        
   50::101     1e-04  41%  147 aa  RIBD1_BUCAI RecName:
   61::108     3e-04  41%  173 aa  TADA_HAEIN RecName: Full=tRNA-specific adenosine deaminase;        
   59::104     4e-04  30%  162 aa  FCYS_SCHPO RecName: Full=Probable cytosine deaminase;       
    1::172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
DCTD_BPT2       MKASTVLQIAYLVSQESKCCSWKVGAVIEKNGRIISTGYNGSPAGG-VNCDNYAAIEGWLKPECVSLAKE
DCTD_BPT4       MKASTVLQIAYLVSQESKCCSWKVGAVIEKNGRIISTGYNGSPAGG-VNCCDYAAEQGWLKPECVSLAKE
COMEB_BACSU     ------MAQSHLLALRSTCPRLSVGATIVRDKRMIAGGYNGSIAGGDEGCDDHC----------------
DCTD_BPMD2      ---------ATAAAQRSDCERSKVGAVVVKDRRVRGTGYNGAPAGGCSTCPRRLSGAGVSDYSSGATR--
YLXG_VIBFI      -------QMAELVGSWSKDPSTQVGAVITKHNRIVSVGFNGYPHGVSDSADTDEREIKYL----------
DCTD_SCHPO      ---SYFMEMASLAAKRSNCMKRRVGCVLVRGNRVIATGYNGTPRGA-TNCNEGGCPRCNSASSCGK----
DCTD_RAT        ---------AFLSAQRSKDPSSQVGAIVNTENKIVGIGYNGMPNG----CSDDLLP--WRRTAENKLDTK
DCTD_MOUSE      ---------AFLSAQRSKDPSSQVGAIVNTENKIVGIGYNGMPNG----CSDDLLP--WRRTAENKLDTK
DCTD_YEAST      ---SYFMKLATLAASRSNCMKRRVGCVIVRECRVIATGYNGTPRGGCPRCNDGDS---------------
DCTD_HUMAN      ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDVLP--WRRTAENKLDTK
DCTD_PONAB      ---------AFLSAQRSKDPNSQVGAIVNSENKIVGIGYNGMPNG----CSDDQLP--WRRTAKNKLDTK
DCTD_DROME      ----------------------QVGAIVDSQNRIVAIGYNGFP----RNCSDDVKGSQEFDPLEDK--KM
DCTD_CAEEL      ------LRIAKVTSLRSKDPNTQVGCVIVKDNCIVSVGYNGFPIG----VDDDVFRWDKEDPEDNKHLYV
CDAC1_DANRE     -----VIRHCVIQARLLACRTEDVGAVIWAEGKLVGCGYNAYPVGSQ-----YAEYPQMDHKQEERQNRK
RIBD_ACTPL      -----------------------VGCVIVKNGEIVAEGY-------------HEKIGGW-----------
FCA1_CANAL      ----------------------------------------------------------------------
Y1319_RICFE     ----------------------------------------------------------------------
Y1426_RICBR     ----------------------------------------------------------------------
Y1285_RICCN     ----------------------------------------------------------------------
RIBD_BACSU      -----------------------VGAVVVKDGQIVGMG--------------------------------
Y819_RICTY      ----------------------------------------------------------------------
TADA_AQUAE      -----------------------VGAIIVKEGEIISKAHNSV---------EELK-----DPT-------
Y831_RICPR      ----------------------------------------------------------------------
RIBD_BACAM      ----------------------------------------------------------------------
RIBD_CORAM      ----------------------------------------------------------------------
CDAC1_PONAB     -----------------------VGAVIWAEGKFVGCGYNAFPVGSEPHMDDKQK-----DREIRKFRYI
CDAC1_MACFA     -----------------------VGAVIWAEGKFVGCGYNAFPVGSEPHMDDKQK-----DREIRKFRYI
CDAC1_HUMAN     -----------------------VGAVIWAEGKFVGCGYNAFPVGSEPHMDDKQK-----DREIRKFRYI
RIBD1_BUCAP     ----------------------------------------------------------------------
RIBD_AQUAE      -----------------------VGAVVVKEGKIVGLGY-------------HEKAG-------------
CDAC1_MOUSE     ----------------------------------IGCGYNAFPVGSEPHMDDKHK-----DREIRKFRYI
TILS_THET8      ----------------------------------------------------------------------
TILS_THET2      ----------------------------------------------------------------------
TADA_BACSU      ----------------------------------------------------------------------
RIBD1_BUCAI     ----------------------------------------------------------------------
TADA_HAEIN      ----------------------------------------------------------------------
FCYS_SCHPO      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPG
DCTD_BPT2       HRSAHSEWSSKNEIHAELNAILFAARNGSSIEGATMYVTLSPCPDCAKAIAQSGIKKLVYCETYDKNKPG
DCTD_BPT4       HRSAHSEWSSKNEIHAELNAILFAARNGSSIEGATMYVTLSPCPDCAKAIAQSGIKKLVYCETYDKNKPG
COMEB_BACSU     ----------ARTIHAEMNAILQCSKFGVPTDGAEIYVTHYPCIQCCKSIIQAGIKTVYYAEDY-KTHPY
DCTD_BPMD2      ----------CVAVHAEANALLYCDR--EDLIGATLYVTREPCYACSNLIAASGIERVVY----------
YLXG_VIBFI      -----------KTLHAEENAILFAKR---DLEGCDIWVTHFPCPNCAAKIIQTGISKVYCPEQTEDFLSR
DCTD_SCHPO      ------ELDTCLCLHAEENALLEAGRERVG-NNAILYCDTCPCLTCSVKITQLGIKEVVYHTSYNMDS--
DCTD_RAT        YPYV---------CHAELNAIMN--KNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
DCTD_MOUSE      YPYV---------CHAELNAIMN--KNSADVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
DCTD_YEAST      -RNLH----TCLCLHAEENALLEAGRDGQN---ATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEES
DCTD_HUMAN      YPYV---------CHAELNAIMN--KNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
DCTD_PONAB      YPYV---------CHAELNAIMN--KNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIF----------
DCTD_DROME      Y-----------VVHAEANAILNS--NGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLY----------
DCTD_CAEEL      -------------VHAEMNAIIN--KRCTTLHDCTVYVTLFPCNKCAQMLIQSRVKKVYFLE-------N
CDAC1_DANRE     YRYI---------LHAEQNALTFRSAEIKAEDNTMMFVTKCPCDECVPLIGCAGIKQIYTTDL-------
RIBD_ACTPL      --------------HAERNAVLHCK---EDLSGATAYVTLEPCPPCSDLLIERGIKKVF-----------
FCA1_CANAL      --QGHNERIQKHSLHGEMSALENAGRPGKTYKDCTIYTTLSPCSMCTGAILLYGFKRVVMGE--NVNFLG
Y1319_RICFE     ---SHNNTEEKNNAHAEIIAINEACNSSKNLNDYDIYVTLEPCAMCAAAIAHSRLKRLFY----------
Y1426_RICBR     --------------HAEIIAINEACRSSKNLSDYDIYVTLEPCAMCAAAIAHSRLKRLFY----------
Y1285_RICCN     ----HNNTEEKNNAHAEIIAINEACNSSKNLNDYDIYVTLEPCAMCAAAIAHSRLKRLFY----------
RIBD_BACSU      ---AHLKYG---EAHAEVHAIHMA---GAHAEGADIYVTLEPCSHCAELIINSGIKRVF-----------
Y819_RICTY      ---SHNNIEEKNNAHAEIIAINEACNSSKNLNDYDIYVTLEPCAMCASAISHSRLKRLFY----------
TADA_AQUAE      ---AHAEMLAIKEACRRLNT--------KYLEGCELYVTLEPCIMCSYALVLSRIEKVIFSAL-------
Y831_RICPR      --------------HAEIIAINTACNSSKNLNDYDIYVTLEPCAMCASAISHSRLKRLFY----------
RIBD_BACAM      ------------EAHAEVHAINMA---GSLAKGADLYVTLEPCSHCAELIMKSGIKRVF-----------
RIBD_CORAM      -------------VHAEVQALADAAGK---TEGATAVVTLEPCRHCTQALIEAGIKDVFLHSDPNPSAGG
CDAC1_PONAB     -------------IHAERNALTFRCQEIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDV-------
CDAC1_MACFA     -------------IHAEQNALTFRCQEIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDV-------
CDAC1_HUMAN     -------------IHAEQNALTFRCQEIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDV-------
RIBD1_BUCAP     ------------ENHAEINALNMA---GEKAKGSTAYITLEPCNHCCDAIIQSGIKNVIISSL-------
RIBD_AQUAE      ------------KPHAEVMAL---GQAGEKAKGATLYVTLEPCTHCTDAIIRSGIKRV------------
CDAC1_MOUSE     -------------IHAEQNALTFRCQDIKPEERSMIFVTKCPCDECVPLIKGAGIKQIYAGDV-------
TILS_THET8      --RAHNRVEGLRDAHAEM---LLLREAGPEARGGRLYVTLEPCLMCHHALAQAGVEVVY-----------
TILS_THET2      --RAHNRVEGLRDAHAEM---LLLREAGPEARGGRLYVTLEPCLMCHHALAQAGVEVVY-----------
TADA_BACSU      --RAHNETEQRSIAHAEMLVIDEACKALGTLEGATLYVTLEPCPMCAGAVVLSRVEKVVF----------
RIBD1_BUCAI     --------------HAEINALIMA---GEKAQGGTAYVTLEPCNHCCNALIKSGINRVVISNI-------
TADA_HAEIN      --------------HAEIIALRNGAKNIQNLLNSTLYVTLEPCTMCAGAILHSRIKRLVF----------
FCYS_SCHPO      --------------HAETRAVGLITKTRRDLEKCTLYTSTEPCAMCSGAIFWSGIRRMIF----------


                         +         .         .         .         .         *         .:210
query           WDEILVKSGIKVIHNKVPLNLLKKxxxxxxxx
DCTD_BPT2       WDDILRNAGIEVFN------------------
DCTD_BPT4       WDDILRNAGIEVFN--VPKKNLNK--------
COMEB_BACSU     AQELFEQAGVTV--------------------
DCTD_BPMD2      --------------------------------
YLXG_VIBFI      WGEMFSQAGVEV--TWLPLDILK---------
DCTD_SCHPO      --------------------------------
DCTD_RAT        --------------------------------
DCTD_MOUSE      --------------------------------
DCTD_YEAST      F-KVLKNAGITV--------------------
DCTD_HUMAN      --------------------------------
DCTD_PONAB      --------------------------------
DCTD_DROME      --------------------------------
DCTD_CAEEL      RDELAFRASKKMLHARLP--------------
CDAC1_DANRE     --------------------------------
RIBD_ACTPL      --------------------------------
FCA1_CANAL      NEKLLIENGVEVVN------------------
Y1319_RICFE     --------------------------------
Y1426_RICBR     --------------------------------
Y1285_RICCN     --------------------------------
RIBD_BACSU      --------------------------------
Y819_RICTY      --------------------------------
TADA_AQUAE      --------------------------------
Y831_RICPR      --------------------------------
RIBD_BACAM      --------------------------------
RIBD_CORAM      GEQVLVDAGINVVQLPSP--------------
CDAC1_PONAB     --------------------------------
CDAC1_MACFA     --------------------------------
CDAC1_HUMAN     --------------------------------
RIBD1_BUCAP     --------------------------------
RIBD_AQUAE      --------------------------------
CDAC1_MOUSE     --------------------------------
TILS_THET8      --------------------------------
TILS_THET2      --------------------------------
TADA_BACSU      --------------------------------
RIBD1_BUCAI     --------------------------------
TADA_HAEIN      --------------------------------
FCYS_SCHPO      --------------------------------