[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for bp441:AAQ81560.1

[Show Plain Result]


## Summary of Sequence Search
    1::145
    4::145     3e-06  27%  147 aa  NDD_BPR70 RecName: Full=Nuclear disruption protein;
    4::149     2e-05  27%  151 aa  NDD_BPT6 RecName: Full=Nuclear disruption protein;
    4::149     4e-05  27%  151 aa  NDD_BPT4 RecName: Full=Nuclear disruption protein;
    4::150     4e-05  27%  152 aa  NDD_BPT2 RecName: Full=Nuclear disruption protein;
    4::150     4e-05  27%  152 aa  NDD_BPR69 RecName: Full=Nuclear disruption protein;
    4::150     4e-05  27%  152 aa  NDD_BPR32 RecName: Full=Nuclear disruption protein;
    4::150     4e-05  27%  152 aa  NDD_BPK3 RecName: Full=Nuclear disruption protein;
    1::145

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGDQETNRGFNET
NDD_BPR70       -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSGSCVSARFYVGNQRSKQGFSAV
NDD_BPT6        -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSSPCVSARFYVGNQRSKQGFSAV
NDD_BPT4        -----MTVTDLNDAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSKPCVSARFYVGNQRSKQGFSAV
NDD_BPT2        -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSKPCVSARFYVGNQRSKQGFSAV
NDD_BPR69       -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSKPCVSARFYVGNQRSKQGFSAV
NDD_BPR32       -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSKPCVSARFYVGNQRSKQGFSAV
NDD_BPK3        -----MTVTDLNNAGATVIGTIKGGEW-FLGTPHKDILSKPGFYFLVSKPCVSARFYVGNQRSKQGFSAV


                         .         .         *         .         .         .         .:140
query           IYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGENMAKAQTLTTVSRQLFKVYNF
NDD_BPR70       LSHIRQRRSQLARTI--ANNNMAYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPT6        LSHIRQRRSQLARTI--ANNNVPYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPT4        LSHIRQRRSQLARTI--ANNNVPYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPT2        LSHIRQRRSQLARTI--ANNNVPYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPR69       LSHIRQRRSQLARTI--ANNNMVYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPR32       LSHIRQRRSQLARTI--ANNNVPYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF
NDD_BPK3        LSHIRQRRSQLARTI--ANNNVPYTVFYLPASKMKPLTKGQLALAFTRNHHSEYQTLEEMNRMLADNFKF


                         +         .         .         .         .         *         .:210
query           EYQxx
NDD_BPR70       VLQ--
NDD_BPT6        VLQ--
NDD_BPT4        VLQ--
NDD_BPT2        VLQ--
NDD_BPR69       VLQ--
NDD_BPR32       VLQ--
NDD_BPK3        VLQ--