[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bp441:AAQ81341.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e1sA.bssp"
#ERROR : Can't open dsspfile "3dmnA.bssp"

## Summary of PDB Search
:439
    2e-08  31%  3e1sA  [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD
    9e-05  13%  3dmnA  [x.x.x] PUTATIVE DNA HELICASE
:439

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVLAAPTHQAKKEL
3e1sA           --------------------------------------------------------VGLCAPTGKAARRL
3dmnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFYTRKLFNILMKTVPSHCVIIG
3e1sA           GEVTGRTASTVHRLLGYGPQGFRHNHLEPAP-------YDLLIVDEVSMMGDALMLSLLAAVPPGARVLL
3dmnA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IGDKAQIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e1sA           VGDTDQL---------------------------------------------------------------
3dmnA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e1sA           ----------------------------------------------------------------------
3dmnA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e1sA           ----------------------------------------------------------------------
3dmnA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxWKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV
3e1sA           ----------------------------------------------------------------------
3dmnA           ---------------------GEQVTLIQTENRLAPGVIVVPSFLAKGLEFDAVIV--WNANQENYQRED


                         .         .         +         .         .         .         .:490
query           AQELIYVGNTRARENVxxx
3e1sA           -------------------
3dmnA           ERQLLYTICSRAHELT---