[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bp441:AAQ81419.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e2iA.bssp"
#ERROR : Can't open dsspfile "2a0fA.bssp"

## Summary of PDB Search
:191
    4e-18  24%  3e2iA  [x.x.x] THYMIDINE KINASE
    2e-04  10%  2a0fA  [x.x.x] ASPARTATE CARBAMOYLTRANSFERASE CATALYTIC CHAIN
:191

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAF
3e2iA           ------------SGKSEELIRRLRRGIYAKQKVVVFKPASHNGNAI----------------EAINISKA
2a0fA           -----------------NLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSM-------HRL


                         .         .         *         .         .         .         .:140
query           CEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEH
3e2iA           SEITHDLTNVDVIGIDEVQFFDDEIVSIVEKLSAD-GHRVIVAGL----DDFRGPFEPPKLAVSEQVTKL
2a0fA           GASVVGFSDSA-----------NTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVL


                         +         .         .         .         .         *         .:210
query           ETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK
3e2iA           QAVCACGSSSSRTQRLINGKPAKIDPIILVGANESYEPRCRAHHIV-----
2a0fA           NANQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFD