[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bp441:AAQ81437.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cm5A.bssp"

## Summary of PDB Search
:122
    1e-21  72%  1cm5A  [c.7.1] PROTEIN (PYRUVATE FORMATE-LYASE)
:122

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFDVQPEPTVEGGQHLNV
1cm5A           -----------------------------------------------------GYFHHEASIEGGQHLNV


                         .         .         *         .         .         .         .:140
query           NVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQSL
1cm5A           NVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM