[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bp441:AAQ81509.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cnhA.bssp"
#ERROR : Can't open dsspfile "3cnhB.bssp"
#ERROR : Can't open dsspfile "3ed5A.bssp"

## Summary of PDB Search
:234
    2e-05  14%  3cnhA  [x.x.x] HYDROLASE FAMILY PROTEIN
    3e-05  15%  3cnhB  [x.x.x] HYDROLASE FAMILY PROTEIN
    3e-05  15%  3ed5A  [x.x.x] YFNB
:234

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMREYNNS
3cnhA           -------LFWDIGGVLLTNGWQRADVAQRFGLDTDDFTERPELELGRTLAEYLEQVVFYQPRDFTPEDFR
3cnhB           -------LFWDIGGVLLTNGWDREDVAQRFGLDTDDERHRLAAPELELGRTLAEYLEQVVFYQPRDFTPE
3ed5A           -------LLFDVDDTILDFQAALRLLFEDQNITNDKAQYKTINQGLRFSALLKEYGYEADGALLEQKYRR


                         .         .         *         .         .         .         .:140
query           DFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFPGAFKDILCVDIGETKMPHYI
3cnhA           AVEEQSQPRPEVLALARDLGQRYRYSLNNEGRDLNEYRIRTFG-----LGEFLLAFFTSSALGVKPNPAY
3cnhB           DFRAVEEQRPEVLALARDLGQRYRYSLNNEGRDLNEYRIRTFG-----LGEFLLAFFTSSALGVKPNPAY
3ed5A           FLEEGHQLIDGAFDLISNLQQQFDLYIVTNGVSHTQYKRLRDSGLFPFFKDIFVSEDT-GFQKPKEYFNY


                         +         .         .         .         .         *         .:210
query           SVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTENAREVKHDIAKYHTAKNWYDIEKLLVNLNx
3cnhA           RLTLAQVRPEEAVVDDRLQNVQAARAV--GHAVQCVDAAQLREELAA-----------------------
3cnhB           RLTLAQVRPEEAVVDDRLQNVQAARAV--GHAVQCVDAAQLREELAA-----------------------
3ed5A           VFERIPAEHTLIIGDSLTADIKGGQLA--GLDTCWNPDKPNVPEIIPT----YEIRKLEELYHILNIEN-


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxx
3cnhA           ------------------------
3cnhB           ------------------------
3ed5A           ------------------------