[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for bp441:AAQ81516.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2b3jD.bssp"
#ERROR : Can't open dsspfile "3b8fC.bssp"
#ERROR : Can't open dsspfile "1af2A.bssp"
#ERROR : Can't open dsspfile "3b8fA.bssp"
#ERROR : Can't open dsspfile "3dh1B.bssp"
#ERROR : Can't open dsspfile "3dmoB.bssp"
#ERROR : Can't open dsspfile "2b3jA.bssp"
#ERROR : Can't open dsspfile "3dh1D.bssp"
#ERROR : Can't open dsspfile "2b3jC.bssp"
#ERROR : Can't open dsspfile "3b8fB.bssp"
#ERROR : Can't open dsspfile "3dh1A.bssp"
#ERROR : Can't open dsspfile "2a8nA.bssp"
#ERROR : Can't open dsspfile "2ab1A.bssp"
#ERROR : Can't open dsspfile "3e1uA.bssp"
#ERROR : Can't open dsspfile "3dmoA.bssp"
#ERROR : Can't open dsspfile "2b3zA.bssp"
#ERROR : Can't open dsspfile "2b3zD.bssp"
#ERROR : Can't open dsspfile "2d30A.bssp"
#ERROR : Can't open dsspfile "2a8nB.bssp"
#ERROR : Can't open dsspfile "1dysA.bssp"
#ERROR : Can't open dsspfile "2ab1B.bssp"
#ERROR : Can't open dsspfile "2ahuA.bssp"
#ERROR : Can't open dsspfile "1a5oC.bssp"

## Summary of PDB Search
:172
    4e-18  30%  2b3jD  [x.x.x] TRNA ADENOSINE DEAMINASE
    1e-17  15%  3b8fC  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    3e-17  22%  1af2A  [c.97.1 - c.97.1] CYTIDINE DEAMINASE
    5e-17  16%  3b8fA  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    4e-16  22%  3dh1B  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    4e-16  23%  3dmoB  [x.x.x] CYTIDINE DEAMINASE
    1e-15  30%  2b3jA  [x.x.x] TRNA ADENOSINE DEAMINASE
    2e-15  22%  3dh1D  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    2e-15  31%  2b3jC  [x.x.x] TRNA ADENOSINE DEAMINASE
    3e-15  17%  3b8fB  [x.x.x] PUTATIVE BLASTICIDIN S DEAMINASE
    3e-15  22%  3dh1A  [x.x.x] TRNA-SPECIFIC ADENOSINE DEAMINASE 2
    1e-14  25%  2a8nA  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    1e-14  12%  2ab1A  [x.x.x] HYPOTHETICAL PROTEIN
    8e-14  14%  3e1uA  [x.x.x] DNA DC->DU-EDITING ENZYME APOBEC-3G
    3e-13  22%  3dmoA  [x.x.x] CYTIDINE DEAMINASE
    1e-12  27%  2b3zA  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    2e-12  31%  2b3zD  [x.x.x] RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD
    1e-11  20%  2d30A  [x.x.x] CYTIDINE DEAMINASE
    1e-06  29%  2a8nB  [x.x.x] CYTIDINE AND DEOXYCYTIDYLATE DEAMINASE
    3e-05   5%  1dysA  [c.6.1] ENDOGLUCANASE
    1e-04  16%  2ab1B  [x.x.x] HYPOTHETICAL PROTEIN
    2e-04  20%  2ahuA  [x.x.x] PUTATIVE ENZYME YDIF
    7e-04  18%  1a5oC  [b.92.1 - c.1.9] UREASE (ALPHA SUBUNIT)
:172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAM
2b3jD           ------MTLAIEEAKKAAQLGEVIGAIITKDDEVIARAHNLRETLQQ-----------------------
3b8fC           ------YDVVKQLIEQRYPNDWGGAAAIRVEDGTIYTSVAPDVINAS----------TELCMETGAILEA
1af2A           ----------------------NVGAIARGVSGTWYFGANMEF---------------------------
3b8fA           ------YDVVKQLIEQRYPNDWGGAAAIRVEDGTIYTSVAPDVINAS-----------------------
3dh1B           ------MEEAMHMAKEALENTEPVGCLMVYNNEVVGKGRNEVNQ--------------TKNA--------
3dmoB           ----------------------KVGAALVTNDGKVFHGCNVENASYGLCN--------------------
2b3jA           ------MTLAIEEAKKAAQLGEVIGAIITKDDEVIARAHNLRETLQQP----------------------
3dh1D           ------MEEAMHMAKEALENTEPVGCLMVYNNEVVGKGRNEVNQTKNATR--------------------
2b3jC           ------MTLAIEEAKKAAQLGEPIGAIITKDDEVIARAHNLRETLQQP----------------------
3b8fB           ------YDVVKQLIEQRYPNDWGGAAAIRVEDGTIYTSVAPDVINAST----------------------
3dh1A           ------MEEAMHMAKEALENTEPVGCLMVYNNEVVGKGRNEVNQTKNATR--------------------
2a8nA           ------MELALVEARSAGERDVPIGAVLVLDGRVIARSGNRTRELNDVTA--------------------
2ab1A           ------------------------------SPEIASLSWGQKVKGS------------------------
3e1uA           ------EPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEG-----------------
3dmoA           ------------------YSNFKVGAALVTNDGKVFHGCNVENASYGLCN--------------------
2b3zA           ------MKLALDLAKQGTESNPLVGAVVVKDGQIVGMGAHLKY---------------------------
2b3zD           ------MKLALDLAKQGTESNPLVGAVVVKDGQIVGMGAHLKYGE-------------------------
2d30A           ------IQEAIEARKQAYVPYSKVGAALLTQDGKVYRGCNVENASYGL----------------------
2a8nB           ------MELALVEARSAGERDEPIGAVLVLDGRVIARSGNRTRELND-----------------------
1dysA           ------IDVAIQNARAAARGENPIVGLVLYN--LPDRDCSAGESSGELKLSQNGLNRY------------
2ab1B           ----------------------------------------------------------------------
2ahuA           ----------------------------------------------------------------------
1a5oC           -----VLTNALIVDHWG----IVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAAEGKIVTAG


                         .         .         *         .         .         .         .:140
query           YRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPG
2b3jD           -----------PTAHAEHIAIERAAKGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPGCSGS
3b8fC           HKF----------QKKVTHSICLAREN-----EHSELKVLSPCGVCQERLFYWGPEVQCAITNAKQDFKP
1af2A           -----IGATMQQTVHAEQSAISHAWLSGEK-ALAAITVNYTPCGHCRQFMNELNSGLDLRIHLPGREAHA
3b8fA           -----------TELCMETGAILEAHKFQKKVTHSSELKVLSPCGVCQERLFYWGPEVQCAITNAKIIFKP
3dh1B           ------------TRHAEMVAIDQVLDWCRVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGS
3dmoB           --------------CAERTALFSALAAGYRPGVGETHGPIAPCGACRQVMIELGKPTLEV----------
2b3jA           ------------TAHAEHIAIERAAKGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDGGCSGS
3dh1D           --------------HAEMVAIDQVLDWCRVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFCGS
2b3jC           ------------TAHAEHIAIERAAKVLGSWRGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGSGS
3b8fB           ------------ELCMETGAILEAHKFQKRENEHSELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIKP
3dh1A           --------------HAEMVAIDQVLDWCRVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGS
2a8nA           --------------HAEIAVIRMACEALGQERGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPGAVES
2ab1A           ------------NTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGSEKVPSS
3e1uA           -------------RHAELCFLDVIPFDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIY
3dmoA           --------------CAERTALFSALAAGYRPGVGETHGPIAPCGACRQVMIELGKPTLEV----------
2b3zA           -----------GEAHAEVHAIHMAGAHAEIYVTLEPCSHYGKTPPCAELIINSGIKRVFVAMRDPNPLVR
2b3zD           -------------AHAEVHAIHMAGAHAE---GADIYVTYGKTPPCAELIINSGIKRVFVAMRDPLVAGR
2d30A           ------------CNCAERTALFKAVSEGDIAIVADTKRPVPPCGACRQVMVELCKQDTKVYLSNLHG---
2a8nB           -----------VTAHAEIAVIRMACEALGQLPGADLYVTLEPCTMCAAAISFARIRRLYYGAQDPK----
1dysA           ---------KNEYVNPFAQKLKAASDVFAVILEPDAIGNMVTGTSAFCRNARGPQQEAIGYAISQLQASH
2ab1B           --------------SPEIASLSWGQKVKGSNTTYKSRTWDGVQPADVKEVVEKGVQTLVIGSEALKVPSS
2ahuA           ----------ILEATTLITALADKYKQTQ---TPRNLSIISPTGRGISPLAQEGLVKWALC-GHWGQSP-
1a5oC           GIDTHIHICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRMLQAADSLPVNIGLLGKGNVS


                         +         .         .         .         .         *         .:210
query           WDEILVKSGIKVIHNKVPLNLLKKExxxxxxx
2b3jD           LMNLLQQSNFNH-RAIVDKGVLKEA-------
3b8fC           LKELQPYHWTEAY-----HDEMVKE-------
1af2A           LRDYLPDAFGPKDL------------------
3b8fA           LKELQPYHWTEA--------------------
3dh1B           VLNIASADLPNTGRPQCIPGYRAEE-------
3dmoB           --------------------------------
2b3jA           LMNLLQQSNFNH-RAIVDKGVLKEA-------
3dh1D           VLNIASADLPNTGRPQCIPGYRAEE-------
2b3jC           LMNLLQQSNFNHRA-IVDKGVLKEA-------
3b8fB           LKELQPYHWTEAYH------------------
3dh1A           VLNIASADLPNTGRPQCIPGYRAEE-------
2a8nA           GVRFFSQPTCHH--------------------
2ab1A           TVEYLKKHGIDVRV------------------
3e1uA           DDQGRCQEGLRTLAE-----------------
3dmoA           --------------------------------
2b3zA           GISMMKEAGIEVRE------------------
2b3zD           GISMMKEAGIEVRE------------------
2d30A           --------------------------------
2a8nB           --------------------------------
1dysA           I-------------------------------
2ab1B           TVEYLKKHGIDVRV------------------
2ahuA           --------------------------------
1a5oC           QPDAL---------------------------