[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for bp441:AAQ81348.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    1::113     2e-19  51%  121 aa  PF03013 Pyr_excise "Pyrimidine dimer DNA glycosylase"
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHVTFFYNKLAWL
PF03013         MTRINLIPPEELPRQHLLGEHRELHALPSALVRSKRGYGKIPEHFTL-----------HVYFFYDKLKYL


                         .         .         *         .         .         .         .:140
query           RDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRTRIAEMIPEKxxxxxxxxxxx
PF03013         YKRHLLLVEEMLKRGYKPNSDWKDDLGPPEYR---GDWTPT----YINRARIAEKIPIK-----------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxx
PF03013         ------------